DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp60D and fab1

DIOPT Version :9

Sequence 1:NP_609656.1 Gene:Hsp60D / 34763 FlyBaseID:FBgn0032525 Length:558 Species:Drosophila melanogaster
Sequence 2:NP_611269.1 Gene:fab1 / 37033 FlyBaseID:FBgn0028741 Length:1809 Species:Drosophila melanogaster


Alignment Length:533 Identity:104/533 - (19%)
Similarity:172/533 - (32%) Gaps:174/533 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 GITVANNVQLGNRRQDMGVQLLRQATNNTNNKVGDGTTTATIL---ARGIACQGMHVLRQSKVNV 128
            |.:.::|....:......|:.|...|:..|    .|.|.:.:|   :..:|.:..:.||..| :.
  Fly   118 GTSTSSNTAAEDSETSDRVETLPLPTSEAN----QGRTVSNVLKHISNIVATKNNNDLRNYK-DT 177

  Fly   129 QLLREGILEGSRAVCDALGEMSQSVDTI------------------GQVEAVAKVALNGDERLAE 175
            :|.|..:.:.....|   .:.||...|.                  .||.....:..:||.::..
  Fly   178 ELQRFWMPDSKAKEC---YDCSQKFSTFRRKHHCRLCGQIFCSKCCNQVVPGMIIRCDGDLKVCN 239

  Fly   176 LIGDII-------------------------LELGDSGVILLKESHSPFDEAKIQEGITIASGYY 215
            ....|:                         ||:.|||..|.|  |.....|.:....::  ||.
  Fly   240 YCSKIVLTFLKSSSSEMGQDMQELQQHLSNKLEVQDSGSSLAK--HPQMQRAPLPRKTSV--GYQ 300

  Fly   216 SPFFAK-----------QSHTLELENCLLLLTLAKIDQVEQILPALELARLKERPLLIIAKNFGS 269
            ...|:.           :.:.|:..|.|:.|.    :::::.||               |:|.|.
  Fly   301 EERFSSHPTYTTLSIDDRKNILQQSNSLITLH----EEMQRDLP---------------AQNCGQ 346

  Fly   270 DLLKILVLNNLQ-GRVQVCAV----KAPSFGDEQCEEMEDIAFATGGHLLEDASSLADLS----- 324
            .|::.|..||.. ..||..|:    .|..|.:....:.|.:.|.:..|.....||.:|.|     
  Fly   347 RLIEFLNSNNKSANEVQAVAILNAMLAAGFLEPIVPDPEQMDFDSSLHYKFSKSSSSDTSRTMSP 411

  Fly   325 --------EEDLGEVMEAVVDAKE-----------------THLLQPINVNEEQVQCRIQDIREL 364
                    |....:.|:...:.||                 :.||.....:|||:..::.....|
  Fly   412 QFEANPHAEPQPPKSMDQSAEEKEKELENELENDRCYTTATSKLLASYCEHEEQLLAQMLRAHNL 476

  Fly   365 IDEAFTDVELDRLKTRLGRLQGHLATIFVGGTSELEVSERKDRFNDALHAVRVAISDGVVPGG-- 427
                  |.|.|::   |..|....|..|           :.:..::.|..:|..::...||||  
  Fly   477 ------DQEWDKV---LQMLCSTAANHF-----------KPEHCSNDLMDIRNYVNFKKVPGGRR 521

  Fly   428 -------GTAYLRCIPVLD---ELPPTDIMELQ------------VGREIV----KDALRLPCYT 466
                   |.|:.:.:...|   .:|...|:.||            |..|.|    |:.||..|  
  Fly   522 KDSKIVHGVAFSKNVAHKDMATHVPFPRILLLQCPIVYERIEGKFVTIETVLLQEKEYLRNVC-- 584

  Fly   467 IARNAGVDPNEVL 479
             ||.....||.||
  Fly   585 -ARIMSFKPNVVL 596

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp60DNP_609656.1 PTZ00114 13..546 CDD:185455 104/533 (20%)
GroEL 18..536 CDD:239460 104/533 (20%)
fab1NP_611269.1 FYVE_PIKfyve_Fab1 182..243 CDD:277264 8/63 (13%)
DEP 329..397 CDD:214489 18/86 (21%)
Fab1_TCP 464..717 CDD:239450 36/156 (23%)
PIPKc 1413..1797 CDD:295374
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453473
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.