DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hacd2 and SBA1

DIOPT Version :9

Sequence 1:NP_609655.2 Gene:Hacd2 / 34762 FlyBaseID:FBgn0032524 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_012805.1 Gene:SBA1 / 853743 SGDID:S000001600 Length:216 Species:Saccharomyces cerevisiae


Alignment Length:137 Identity:38/137 - (27%)
Similarity:60/137 - (43%) Gaps:14/137 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LSPFVYWSQTKQT-------LLLKVDLKDAKGAIADFSPVSVNFSANGH---GARGVNAYKFELH 58
            ::|.|.|:|...|       :|:.|.:.|.........|..:...|...   |...|:.|:..:.
Yeast     6 INPQVAWAQRSSTTDPERNYVLITVSIADCDAPELTIKPSYIELKAQSKPHVGDENVHHYQLHID 70

  Fly    59 FYALIDDENATFVVSDNK---IELQIRKLEPEWWPRLVATPQKPHWLKIDFDRWRTEDDV-EVEE 119
            .|..|..|.....|::.:   ::|..:.||.|:||||.....|..::|.|||:|..||:. |||.
Yeast    71 LYKEIIPEKTMHKVANGQHYFLKLYKKDLESEYWPRLTKEKVKYPYIKTDFDKWVDEDEQDEVEA 135

  Fly   120 KPRDVRQ 126
            :..|..|
Yeast   136 EGNDAAQ 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hacd2NP_609655.2 p23_hB-ind1_like 6..114 CDD:107222 32/120 (27%)
PTPLA 197..357 CDD:282269
SBA1NP_012805.1 p23_hB-ind1_like 8..129 CDD:107222 32/120 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1673
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.