DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hacd2 and PHS1

DIOPT Version :9

Sequence 1:NP_609655.2 Gene:Hacd2 / 34762 FlyBaseID:FBgn0032524 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_012438.1 Gene:PHS1 / 853348 SGDID:S000003633 Length:217 Species:Saccharomyces cerevisiae


Alignment Length:209 Identity:51/209 - (24%)
Similarity:93/209 - (44%) Gaps:20/209 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 YMIFYNLAMFVGYLYIMVVMGVLYYRDGVDSIGKTYANVGNAFKFIQLLQYLEVMHPMFGYTKGS 215
            ::..|||...||:.|::.::..||.:.|..:.   :....|....:|....:|:::...|..:..
Yeast    11 FLPLYNLLSAVGWSYLLYLVISLYPKVGQPAF---FYQTKNVATLVQCGAIIEIINSFLGVVRSP 72

  Fly   216 PVVPFFQVSGRNFILFLMIDMEPRMYAKPVVFYVFII--WSLVELVRYPYYLAQLLGREVG--LL 276
            .:....|||.|..::..:..:.|.......|.|:.::  ||:.|:|||.||...|:.:...  :|
Yeast    73 LLTTVAQVSSRLLVVLGIFQLLPNTSGVQSVVYISLLLAWSITEIVRYLYYFFMLVFKNGAPKIL 137

  Fly   277 TWLRYTIWIPLYPMGILCEGIIVLRNIPYIEETKRFTVEMPNPWNITFDMVLFLKIYLMLLIIPG 341
            ..|||.::..|||.|:..|..|:...:...|          :.:::.:..:|   |..||..|||
Yeast   138 ILLRYNLFWILYPTGVASELRIIYCALNAAE----------SQYSLLYKRIL---IAAMLAYIPG 189

  Fly   342 SYLVMSHMAKLRSK 355
            ..::..||...|.|
Yeast   190 FPMLFLHMVAQRKK 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hacd2NP_609655.2 p23_hB-ind1_like 6..114 CDD:107222
PTPLA 197..357 CDD:282269 41/163 (25%)
PHS1NP_012438.1 Ptpl 1..217 CDD:227525 51/209 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344691
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5198
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.700

Return to query results.
Submit another query.