DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hacd2 and AT5G59770

DIOPT Version :9

Sequence 1:NP_609655.2 Gene:Hacd2 / 34762 FlyBaseID:FBgn0032524 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001318841.1 Gene:AT5G59770 / 836098 AraportID:AT5G59770 Length:221 Species:Arabidopsis thaliana


Alignment Length:223 Identity:59/223 - (26%)
Similarity:105/223 - (47%) Gaps:15/223 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 KVYMIFYNLAMFVGY-LYIMVVMGVLYYRDGVDSIGKTYANVGNAFKFIQLLQYLEVMHPMFGYT 212
            |.|:..||......: :.:::::........:.|   .||:.|......|....|||:|...|..
plant     6 KFYLFSYNFLQASAWAISLLIILNSFLSNKTIIS---AYASAGFLISLFQTAAILEVLHGAIGIV 67

  Fly   213 KGSPVVPFFQVSGRNFILFLMIDMEPRMYAKPVVFYVFIIWSLVELVRYPYYLAQLLGREVGLLT 277
            ....:.|..|.|||...:..::.....:...|.:....:.|.:.|::|||:|....|||....||
plant    68 PSGFLSPLMQWSGRTHFILAIVGQIKEVQDSPWLSITLVAWCIGEMIRYPHYAFTCLGRCPYWLT 132

  Fly   278 WLRYTIWIPLYPMGILCEGIIVLRNIPYIEETKRFTVEMPNPWNITFDMVLFLKIYLMLLIIPGS 342
            :||||.:|.:||.|::.|.:|:.:.:||::|...:.    |.::: |....:..::.:||:.|..
plant   133 YLRYTGFIVIYPTGLVGELLIMYKALPYVKERNLYA----NFFSV-FPFSYYDFLWAVLLVYPFL 192

  Fly   343 YL-VMSHMAKLRSKKLGK-----GRAKR 364
            :| :...:.|.|..||||     |:.||
plant   193 WLKLYLQLFKQRKSKLGKSKKLHGKRKR 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hacd2NP_609655.2 p23_hB-ind1_like 6..114 CDD:107222
PTPLA 197..357 CDD:282269 44/160 (28%)
AT5G59770NP_001318841.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5198
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1458293at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11035
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.