DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hacd2 and AT4G02450

DIOPT Version :9

Sequence 1:NP_609655.2 Gene:Hacd2 / 34762 FlyBaseID:FBgn0032524 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_192154.2 Gene:AT4G02450 / 828006 AraportID:AT4G02450 Length:241 Species:Arabidopsis thaliana


Alignment Length:114 Identity:35/114 - (30%)
Similarity:56/114 - (49%) Gaps:11/114 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PFVYWSQTKQTLLLKVDLKDAKGAIADFSPVSV-NFSA----NGHGARGVNAYKFELHFYALIDD 65
            |.|.|::|.:.:.|.|.|.|.|....:..|..| :|||    ..|      .|:.:|.....::.
plant     5 PEVKWAETTEKIFLTVVLADTKDTKVNLDPEGVFDFSAKVGPENH------VYELKLELADKVNV 63

  Fly    66 ENATFVVSDNKIELQIRKLEPEWWPRLVATPQKPHWLKIDFDRWRTEDD 114
            |.:...:.:..|...|.|.|||.|.:|:...:.||::|:|:|:|..|||
plant    64 EESKINIGERSIFCIIEKAEPERWNKLLRVKKPPHYVKVDWDKWVDEDD 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hacd2NP_609655.2 p23_hB-ind1_like 6..114 CDD:107222 33/112 (29%)
PTPLA 197..357 CDD:282269
AT4G02450NP_192154.2 p23_hB-ind1_like 5..112 CDD:107222 33/112 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.