DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hacd2 and Tdrd12

DIOPT Version :9

Sequence 1:NP_609655.2 Gene:Hacd2 / 34762 FlyBaseID:FBgn0032524 Length:371 Species:Drosophila melanogaster
Sequence 2:XP_038956788.1 Gene:Tdrd12 / 689639 RGDID:1562792 Length:1314 Species:Rattus norvegicus


Alignment Length:114 Identity:26/114 - (22%)
Similarity:47/114 - (41%) Gaps:11/114 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PFVYWSQTKQTLLLKVDLKDAKGAIADFSPVSVNFSANGHGARGVNAYKFELHFYALIDDENATF 70
            |.:.|.|....::||:.:::.|.....|....|.|||    ..|...|..::.....|..::...
  Rat  1175 PQIKWFQKDDHIILKIKIRNVKDYKCKFFTDRVIFSA----WVGDKFYLADMELQGDIRKDDCKC 1235

  Fly    71 VVSDNKIELQIRKLEPEWWPRLVATPQKPHWLKIDFDRWRTEDDVEVEE 119
            ::.|::..:.:.|.:...|..|:  .|:...:..|||.|.     |.||
  Rat  1236 IIKDDEPLITLAKEKRACWCGLL--KQRNPNVAFDFDHWE-----ECEE 1277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hacd2NP_609655.2 p23_hB-ind1_like 6..114 CDD:107222 23/107 (21%)
PTPLA 197..357 CDD:282269
Tdrd12XP_038956788.1 Tudor_TDRD12_rpt1 13..171 CDD:410505
SrmB 428..862 CDD:223587
Tudor_TDRD12_rpt2 900..1022 CDD:410506
p23_like 1179..1254 CDD:107220 15/78 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.