Sequence 1: | NP_609655.2 | Gene: | Hacd2 / 34762 | FlyBaseID: | FBgn0032524 | Length: | 371 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001364027.1 | Gene: | Hacd4 / 66775 | MGIID: | 1914025 | Length: | 232 | Species: | Mus musculus |
Alignment Length: | 202 | Identity: | 67/202 - (33%) |
---|---|---|---|
Similarity: | 109/202 - (53%) | Gaps: | 3/202 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 148 KKVYMIFYNLAMFVGYLYIMVVMGVLYYRDGVDSIGKTYANVGNAFKFIQLLQYLEVMHPMFGYT 212
Fly 213 KGSPVVPFFQVSGRNFILFLMIDMEPRMYAKPVVFYVFIIWSLVELVRYPYYLAQLLGREVGLLT 277
Fly 278 WLRYTIWIPLYPMGILCEGIIVLRNIPYIEETKRFTVEMPNPWNITFDMVLFLKIYLMLLIIPGS 342
Fly 343 YLVMSHM 349 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Hacd2 | NP_609655.2 | p23_hB-ind1_like | 6..114 | CDD:107222 | |
PTPLA | 197..357 | CDD:282269 | 52/153 (34%) | ||
Hacd4 | NP_001364027.1 | PTPLA | 65..223 | CDD:398198 | 52/153 (34%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167841878 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1458293at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR11035 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.950 |