DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hacd2 and Hacd4

DIOPT Version :9

Sequence 1:NP_609655.2 Gene:Hacd2 / 34762 FlyBaseID:FBgn0032524 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001364027.1 Gene:Hacd4 / 66775 MGIID:1914025 Length:232 Species:Mus musculus


Alignment Length:202 Identity:67/202 - (33%)
Similarity:109/202 - (53%) Gaps:3/202 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 KKVYMIFYNLAMFVGYLYIMVVMGVLYYRDGVDSIGKTYANVGNAFKFIQLLQYLEVMHPMFGYT 212
            |.||:..|.|..|.|:.:|:..|.|.::..|.||:..|:..:|...:..|.:..||::|...|..
Mouse    16 KNVYLFIYYLIQFCGHSWILANMTVRFFSFGKDSMADTFYAIGLVMRVCQSISLLELLHIYIGIE 80

  Fly   213 KGSPVVPFFQVSGRNFILFLMIDMEPRMYAKPVVFYVFIIWSLVELVRYPYYLAQLLGREVGLLT 277
            .......|.|::.|..|||.:|..:..:..|.||..:||:|:|:::|||.|.:..::|.....||
Mouse    81 SNQLFPRFLQLTERVIILFGVITSQEEVQEKCVVCVLFILWNLLDMVRYTYSMLSVIGTSYAALT 145

  Fly   278 WLRYTIWIPLYPMGILCEGIIVLRNIPYIEETKRFTVEMPNPWNITFDMVLFLKIYLMLLIIPGS 342
            ||..|:|:|:||:.:|.|...:.:::||.|.....:..:|...:..|..|  ||:|||:|.| |.
Mouse   146 WLSQTLWMPIYPLCVLAEAFTIYQSLPYFESFGTNSTVLPFDLSTCFPYV--LKLYLMMLFI-GM 207

  Fly   343 YLVMSHM 349
            |...||:
Mouse   208 YFTYSHL 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hacd2NP_609655.2 p23_hB-ind1_like 6..114 CDD:107222
PTPLA 197..357 CDD:282269 52/153 (34%)
Hacd4NP_001364027.1 PTPLA 65..223 CDD:398198 52/153 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841878
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1458293at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11035
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.