DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hacd2 and hacd4

DIOPT Version :9

Sequence 1:NP_609655.2 Gene:Hacd2 / 34762 FlyBaseID:FBgn0032524 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001186940.2 Gene:hacd4 / 561303 ZFINID:ZDB-GENE-030131-3627 Length:222 Species:Danio rerio


Alignment Length:224 Identity:69/224 - (30%)
Similarity:109/224 - (48%) Gaps:20/224 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 LGYIKEKTKKVYMIFYNLAMFVGYLYIMVVMGVLYYRDGVDSIGKTYANVGNAFKFIQLLQYLEV 204
            ||:|       |:..|||..|.|:.:|...|...:...|.|:...|:..|.......|||..||:
Zfish     5 LGFI-------YLFSYNLLQFCGHTWIFANMTARFLSFGKDAQFGTFYFVAVMMGACQLLSLLEL 62

  Fly   205 MHPMFGYTKGSPVVPFFQVSGRNFILFLMIDMEPRMYAKPVVFYVFIIWSLVELVRYPYYLAQLL 269
            .|...|:.:......|.||..||.:|||:|.:| ...:||:|...|.:|:::.|:|||:.|..|:
Zfish    63 FHIADGFDECRLFPRFMQVIERNVLLFLLISLE-EFQSKPIVCVQFYLWNILGLLRYPHRLFCLI 126

  Fly   270 GREVGLLTWLRYTIWIPLYPMGILCEGIIVLRNIPYIEE---TKRFTVEMPNPWNITFDMVLFLK 331
            |.....:.|:..|:.||:|.|..:.|||.:...:||:.|   |.....::|.|      |.::..
Zfish   127 GTPYFKMLWVHQTLTIPVYLMSAVTEGISIFLMLPYLSESEGTDSVQPKVPAP------MYMYSP 185

  Fly   332 IYLM---LLIIPGSYLVMSHMAKLRSKKL 357
            ..:|   ||::.||.|.:..:.|.|.:.|
Zfish   186 YIVMSWILLLVLGSSLTVLLLLKERKENL 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hacd2NP_609655.2 p23_hB-ind1_like 6..114 CDD:107222
PTPLA 197..357 CDD:282269 53/165 (32%)
hacd4NP_001186940.2 PTPLA 55..216 CDD:321828 54/167 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586358
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1458293at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11035
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.