DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hacd2 and p23

DIOPT Version :9

Sequence 1:NP_609655.2 Gene:Hacd2 / 34762 FlyBaseID:FBgn0032524 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001247010.1 Gene:p23 / 41173 FlyBaseID:FBgn0037728 Length:184 Species:Drosophila melanogaster


Alignment Length:160 Identity:39/160 - (24%)
Similarity:63/160 - (39%) Gaps:39/160 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LSPFVYWSQTKQTL--LLKVDLKDAKGAIADFSPVSVNFSANGHGARGVNA------YKFELHFY 60
            :.|.|.|:|....:  ::.|:.||.:..:.:   .:..|       :|||.      |:..|:|.
  Fly     8 IPPPVSWAQRNDLIYVIIDVECKDIEHKVTE---KTFTF-------KGVNVLDPSKKYEVTLNFL 62

  Fly    61 ALIDDENATFVVSDNKIELQI-RKLEPEWWPRLVATPQKPHWLKIDFDRWRTE-DDVEVEEKPR- 122
            ..:|.|..|.......:|..| :|....:|..|.....|.|:||.:|.:||.| ||.|.::|.. 
  Fly    63 HEVDPEKVTSKNIGRCLEFTIPKKAAGPYWSSLTTDKTKLHFLKANFAKWRDESDDEEGDQKDNS 127

  Fly   123 ------------------DVRQDYEKEYAD 134
                              |...|.|:|.:|
  Fly   128 MFGNFLNSPGGDWNNKFDDFNVDDEEEDSD 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hacd2NP_609655.2 p23_hB-ind1_like 6..114 CDD:107222 30/117 (26%)
PTPLA 197..357 CDD:282269
p23NP_001247010.1 p23_hB-ind1_like 10..117 CDD:107222 30/116 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1673
SonicParanoid 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.