Sequence 1: | NP_609655.2 | Gene: | Hacd2 / 34762 | FlyBaseID: | FBgn0032524 | Length: | 371 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001308832.1 | Gene: | HACD4 / 401494 | HGNCID: | 20920 | Length: | 283 | Species: | Homo sapiens |
Alignment Length: | 262 | Identity: | 70/262 - (26%) |
---|---|---|---|
Similarity: | 115/262 - (43%) | Gaps: | 54/262 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 148 KKVYMIFYNLAMFVGYLYIMVVMGVLYYRDGVDSIGKTYANVGNAFKFIQLLQYLEVMHPMFGYT 212
Fly 213 KGSPVVPFFQVSGRNFILFLMIDMEPRMYAKPVVFYVFIIWSLVELVRYPYYLAQLLGREVGLLT 277
Fly 278 WLRYTIWIPLYPMGILCE----------------------------------------------- 295
Fly 296 ----GIIVLRNIPYIEETKRFTVEMPNPWNITFDMVLFLKIYLMLLIIPGSYLVMSHMAKLRSKK 356
Fly 357 LG 358 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Hacd2 | NP_609655.2 | p23_hB-ind1_like | 6..114 | CDD:107222 | |
PTPLA | 197..357 | CDD:282269 | 54/210 (26%) | ||
HACD4 | NP_001308832.1 | PTPLA | 65..273 | CDD:282269 | 54/210 (26%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165151774 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5198 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1458293at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR11035 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
5 | 4.850 |