DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hacd2 and HACD4

DIOPT Version :9

Sequence 1:NP_609655.2 Gene:Hacd2 / 34762 FlyBaseID:FBgn0032524 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001308832.1 Gene:HACD4 / 401494 HGNCID:20920 Length:283 Species:Homo sapiens


Alignment Length:262 Identity:70/262 - (26%)
Similarity:115/262 - (43%) Gaps:54/262 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 KKVYMIFYNLAMFVGYLYIMVVMGVLYYRDGVDSIGKTYANVGNAFKFIQLLQYLEVMHPMFGYT 212
            |..|:..|.|..|.|:.:|...|.|.::..|.||:..|:..:|...:..|.:..||::|...|..
Human    16 KNAYLFIYYLIQFCGHSWIFTNMTVRFFSFGKDSMVDTFYAIGLVMRLCQSVSLLELLHIYVGIE 80

  Fly   213 KGSPVVPFFQVSGRNFILFLMIDMEPRMYAKPVVFYVFIIWSLVELVRYPYYLAQLLGREVGLLT 277
            ....:..|.|::.|..|||::|..:..:..|.||..:|:.|:|:::|||.|.:..::|....:||
Human    81 SNHLLPRFLQLTERIIILFVVITSQEEVQEKYVVCVLFVFWNLLDMVRYTYSMLSVIGISYAVLT 145

  Fly   278 WLRYTIWIPLYPMGILCE----------------------------------------------- 295
            ||..|:|:|:||:.:|.|                                               
Human   146 WLSQTLWMPIYPLCVLAEEAKLKREAALHSRQNTGQKATASEAFTSLTHCMKPSSCRKISSGLPL 210

  Fly   296 ----GIIVLRNIPYIEETKRFTVEMPNPWNITFDMVLFLKIYLMLLIIPGSYLVMSHMAKLRSKK 356
                ...:.:::||.|....::.::|...:|.|..|  ||||||:|.| |.|...||:...|...
Human   211 ILHYAFAIYQSLPYFESFGTYSTKLPFDLSIYFPYV--LKIYLMMLFI-GMYFTYSHLYSERRDI 272

  Fly   357 LG 358
            ||
Human   273 LG 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hacd2NP_609655.2 p23_hB-ind1_like 6..114 CDD:107222
PTPLA 197..357 CDD:282269 54/210 (26%)
HACD4NP_001308832.1 PTPLA 65..273 CDD:282269 54/210 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151774
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5198
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1458293at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11035
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.