DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hacd2 and Hacd4

DIOPT Version :9

Sequence 1:NP_609655.2 Gene:Hacd2 / 34762 FlyBaseID:FBgn0032524 Length:371 Species:Drosophila melanogaster
Sequence 2:XP_006238438.1 Gene:Hacd4 / 362540 RGDID:1310339 Length:237 Species:Rattus norvegicus


Alignment Length:220 Identity:67/220 - (30%)
Similarity:112/220 - (50%) Gaps:14/220 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 KKVYMIFYNLAMFVGYLYIMVVMGVLYYRDGVDSIGKTYANVGNAFKFIQLLQYLEVMHPMFGYT 212
            |..|:..|.|..|.|:.:|:..|.|.::..|.||:..|:..:|...:..|.:..||::|...|..
  Rat    16 KSAYLFIYYLIQFCGHSWILTNMTVRFFSFGKDSMVDTFYAIGLVMRVCQSISLLELLHIYIGIE 80

  Fly   213 KGSPVVPFFQVSGRNFILFLMIDMEPRMYAKPVVFYVFIIWSLVELVRYPYYLAQLLGREVGLLT 277
            .......|.|::.|..|||.:|..:..:..|.||..:||.|:|:::|||.|.:..::|....:||
  Rat    81 SNQLFPKFLQLTERIIILFGVITSQEEVQEKYVVCVLFIFWNLLDMVRYTYSMLSVIGTSYAVLT 145

  Fly   278 WLRYTIWIPLYPMGILCEGIIVLRNIPYIEETKRFTVEMPNPWNITFDMVLF----LKIYLMLLI 338
            ||..|:|:|:||:.:|.|...:.:::||.|...:.:..:|      ||:..:    ||:|||:|.
  Rat   146 WLSQTLWMPIYPLCVLAEAFTIYQSLPYFELFGKNSTMLP------FDISTYFPYVLKLYLMMLF 204

  Fly   339 IPGSYLVMSHMAKLRSKKLGKGRAK 363
            |    .:.....|..|:.|...|.|
  Rat   205 I----AIFIRKEKTSSEDLLSNRRK 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hacd2NP_609655.2 p23_hB-ind1_like 6..114 CDD:107222
PTPLA 197..357 CDD:282269 50/163 (31%)
Hacd4XP_006238438.1 PTPLA 65..209 CDD:282269 48/153 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345262
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5198
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1458293at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11035
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.810

Return to query results.
Submit another query.