DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hacd2 and hacd2

DIOPT Version :9

Sequence 1:NP_609655.2 Gene:Hacd2 / 34762 FlyBaseID:FBgn0032524 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_956155.1 Gene:hacd2 / 334121 ZFINID:ZDB-GENE-030131-6053 Length:239 Species:Danio rerio


Alignment Length:224 Identity:69/224 - (30%)
Similarity:114/224 - (50%) Gaps:7/224 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 ELGYIKEK----TKKVYMIFYNLAMFVGYLYIMVVMGVLYYRDGVDSIGKTYANVGNAFKFIQLL 199
            |.|:.|:|    ....|::.||:.|..|:|.|.|.:...|...|  |....|.::....||.|..
Zfish    10 ESGHKKKKGPGTLATAYLVIYNVIMTAGWLVIAVGLVRAYLARG--SYHGLYYSIEKPLKFFQTG 72

  Fly   200 QYLEVMHPMFGYTKGSPVVPFFQVSGRNFILFLMIDMEPRMYAKPVVFYVFIIWSLVELVRYPYY 264
            ..||::|...|....|.|:..|||..|.|:.:.:......:.::..|....:.|::.|::||.:|
Zfish    73 ALLEILHCAVGIVPSSVVLTGFQVMSRVFLTWAVTHSVREVQSEDSVLLFVVAWTVTEIIRYSFY 137

  Fly   265 LAQLLGREVGLLTWLRYTIWIPLYPMGILCEGIIVLRNIPYIEETKRFTVEMPNPWNITFDMVLF 329
            ...||.....|:.|.|||.:|.|||||::.|.:.:...:||:::...:::.:||.:|.:||...|
Zfish   138 TFSLLNHLPYLIKWARYTFFIVLYPMGVMGELLTIYAALPYVQKAGLYSITLPNKYNFSFDYHTF 202

  Fly   330 LKIYLMLLIIPGSYLVMSHMAKLRSKKLG 358
            | |::|:..||....:..||.:.|.|.||
Zfish   203 L-IFVMISYIPLFPQLYFHMMRQRKKVLG 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hacd2NP_609655.2 p23_hB-ind1_like 6..114 CDD:107222
PTPLA 197..357 CDD:282269 49/159 (31%)
hacd2NP_956155.1 PTPLA 70..229 CDD:282269 49/159 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5198
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1458293at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.