DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hacd2 and Hacd1

DIOPT Version :9

Sequence 1:NP_609655.2 Gene:Hacd2 / 34762 FlyBaseID:FBgn0032524 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_038963.3 Gene:Hacd1 / 30963 MGIID:1353592 Length:248 Species:Mus musculus


Alignment Length:235 Identity:73/235 - (31%)
Similarity:121/235 - (51%) Gaps:20/235 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 EKEYADLQKRELGYIKEKTKKVYMIFYNLAMFVGYLYIMVVMGVLYYRDGVDSIGKTYANVGNAF 193
            |||.|. ::|.||.:    ...::.|||:||..|:|.:.:.|...|...|...  ..|.::....
Mouse    18 EKEAAG-KRRRLGLL----ATAWLTFYNIAMTAGWLVLAIAMVRFYMEKGTHR--GLYKSIQKTL 75

  Fly   194 KFIQLLQYLEVMHPMFGYTKGSPVVPFFQVSGRNFILFLMI-DMEPRMYAKPVVFYVFIIWSLVE 257
            ||.|....|||:|.:.|....|.:|...|||.|.|:::|:. .::|....:.||.:: :.|::.|
Mouse    76 KFFQTFALLEVVHCLIGIVPTSVLVTGVQVSSRIFMVWLITHSIKPIQNEESVVLFL-VSWTVTE 139

  Fly   258 LVRYPYYLAQLLGREVGLLTWLRYTIWIPLYPMGILCEGIIVLRNIPYIEETKRFTVEMPNPWNI 322
            :.||.:|...||......:.|.||.::|.|||:|:..|.:.:...:||::::..|:|.:||.:|:
Mouse   140 ITRYSFYTFSLLDHLPHFIKWARYNLFIILYPVGVAGELLTIYAALPYVKKSGMFSVRLPNKYNV 204

  Fly   323 TFDMVLFLKIYLMLLIIPGSYL-----VMSHMAKLRSKKL 357
            :||      .|..|||...||:     :..||.:.|.|.|
Mouse   205 SFD------YYYFLLITMASYIPLFPQLYFHMLRQRRKVL 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hacd2NP_609655.2 p23_hB-ind1_like 6..114 CDD:107222
PTPLA 197..357 CDD:282269 52/165 (32%)
Hacd1NP_038963.3 PTPLA 79..238 CDD:282269 52/165 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5198
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.