DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hacd2 and wos2

DIOPT Version :9

Sequence 1:NP_609655.2 Gene:Hacd2 / 34762 FlyBaseID:FBgn0032524 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_594586.1 Gene:wos2 / 2542472 PomBaseID:SPAC9E9.13 Length:186 Species:Schizosaccharomyces pombe


Alignment Length:126 Identity:38/126 - (30%)
Similarity:58/126 - (46%) Gaps:20/126 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PFVYWSQ-------TKQTLLLKVDLKDAKGAIADFSP----VSVNFSANGHGARGVNAYKFELHF 59
            |.|.|:|       .|..:.|.|.:.||.....:.:|    :.....||.|       |..::.|
pombe     8 PEVLWAQRSNKDDAEKNVIYLTVLIPDAVDPKINLTPEKLVIDSKSGANAH-------YAVQIDF 65

  Fly    60 YALIDDENATFVVSDNKI--ELQIRKLEPEWWPRLVATPQKPHWLKIDFDRWRTEDDVEVE 118
            :..||.|.:.:.|:...|  .|..::|:.|:||||.....:.|||:.|||||..||:.|.:
pombe    66 FKDIDVEKSKYSVTGRYIFFVLYKKELQEEFWPRLTKEKLRLHWLRTDFDRWVDEDEQEAQ 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hacd2NP_609655.2 p23_hB-ind1_like 6..114 CDD:107222 36/120 (30%)
PTPLA 197..357 CDD:282269
wos2NP_594586.1 p23_hB-ind1_like 8..122 CDD:107222 36/120 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1673
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.