DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hacd2 and SPBC19C2.15c

DIOPT Version :9

Sequence 1:NP_609655.2 Gene:Hacd2 / 34762 FlyBaseID:FBgn0032524 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_595700.1 Gene:SPBC19C2.15c / 2540685 PomBaseID:SPBC19C2.15c Length:208 Species:Schizosaccharomyces pombe


Alignment Length:222 Identity:57/222 - (25%)
Similarity:102/222 - (45%) Gaps:30/222 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 YMIFYNLAMFVGYLYIMVVMGVLYYRDGV-DSIGKTYANVGNAFKFIQLLQYLEVMHPMFGYTKG 214
            |:..||:.....::.:::..|:::   |: ......:.......:::|.|...||.|.:||....
pombe     9 YLKLYNVISCFLWMSVLLRTGLIW---GITKDTAVVFHETNTLVRWVQTLAIAEVFHSIFGLVSS 70

  Fly   215 SPVVPFFQVSGRNFILFLMIDMEPRMY---AKPVVFYVFIIWSLVELVRYPYYLAQLLGREVGLL 276
            ||:....||:.|.::::.:  ..|..|   ..|:...:.|.||:.|::||.:|...|.|.....|
pombe    71 SPLTTIIQVASRLYLVWGV--CYPFSYVIEGSPIYLSMIIAWSITEIIRYAFYAFNLNGDIPAFL 133

  Fly   277 TWLRYTIWIPLYPMGILCEGIIVLRN---IPYIEETKRFTVEMPNPWNITFDMVLFLKIYLMLLI 338
            |||||..::.|||:|...|.::||::   ..|:....:..      |.|           ||.:.
pombe   134 TWLRYNTFLILYPIGAGSEFLLVLKSRIAAQYVWSLNKLL------WPI-----------LMSIY 181

  Fly   339 IPGSYLVMSHMAKLRSKKLGKGRAKRQ 365
            .||.|::.:||...| :|:.|..|.|:
pombe   182 PPGLYIMYTHMLAQR-RKISKRAAARR 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hacd2NP_609655.2 p23_hB-ind1_like 6..114 CDD:107222
PTPLA 197..357 CDD:282269 48/165 (29%)
SPBC19C2.15cNP_595700.1 Ptpl 1..208 CDD:227525 57/222 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5198
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.