DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hacd2 and hpo-8

DIOPT Version :9

Sequence 1:NP_609655.2 Gene:Hacd2 / 34762 FlyBaseID:FBgn0032524 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_504740.2 Gene:hpo-8 / 188513 WormBaseID:WBGene00020517 Length:218 Species:Caenorhabditis elegans


Alignment Length:223 Identity:68/223 - (30%)
Similarity:116/223 - (52%) Gaps:14/223 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 KVYMIFYNLAMFVGYLYIMV--VMGVLYYRDGVDSIGKTYANVGNAFKFIQLLQYLEVMHPMFGY 211
            :.|::.||:...:|:..|:|  |:|:   .:|: :..:.|.:|....|..|....|||:|.:.|.
 Worm     4 QTYLVAYNVLQILGWSAILVKTVLGL---ANGL-TWPQLYESVEFELKIFQTAAILEVIHAIVGL 64

  Fly   212 TKGSPV-VPFFQVSGRNFILFLMIDMEPRMYAKPVVFYVFIIWSLVELVRYPYYLAQLLGREVG- 274
            .: ||| ....||:.|..:::.::.:.........|..:.:.||:.|::||.:|...:|.:.:. 
 Worm    65 VR-SPVGTTAMQVTSRVVLVWPILHLCSTARFSIGVPLLLVAWSVTEVIRYSFYALSVLKQPIPY 128

  Fly   275 LLTWLRYTIWIPLYPMGILCEGIIVLRNIPYIEETKRFTVEMPNPWN--ITFDMVLFLKIYLMLL 337
            .|.:||||::..|||||:..|.:.:..::..::|.|..|:||||..|  |:|..||   |...|.
 Worm   129 FLLYLRYTLFYVLYPMGVSGELLTLFASLNEVDEKKILTLEMPNRLNMGISFWWVL---IIAALS 190

  Fly   338 IIPGSYLVMSHMAKLRSKKLGKGRAKRQ 365
            .|||...:..:|...|.|.||.|..|:|
 Worm   191 YIPGFPQLYFYMIGQRKKILGGGSKKKQ 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hacd2NP_609655.2 p23_hB-ind1_like 6..114 CDD:107222
PTPLA 197..357 CDD:282269 51/163 (31%)
hpo-8NP_504740.2 PTPLA 50..210 CDD:282269 51/163 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5198
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1458293at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.