DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hacd2 and hacd4

DIOPT Version :9

Sequence 1:NP_609655.2 Gene:Hacd2 / 34762 FlyBaseID:FBgn0032524 Length:371 Species:Drosophila melanogaster
Sequence 2:XP_017953281.1 Gene:hacd4 / 100490902 XenbaseID:XB-GENE-995575 Length:224 Species:Xenopus tropicalis


Alignment Length:217 Identity:65/217 - (29%)
Similarity:114/217 - (52%) Gaps:10/217 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 KVYMIFYNLAMFVGYLYIMVVMGVLYYRDGVDSIGKTYANVGNAFKFIQLLQYLEVMHPMFGYTK 213
            |.|:..|.|..|.|:.:|...|...:...|.|:...|:.::|...:..|||..||:.|.:.|..:
 Frog     8 KTYLSIYYLLQFCGHSWIFTNMTARFLFFGQDAFADTFYSIGLVMQGCQLLSVLELAHILLGVEQ 72

  Fly   214 GSPVVPFFQVSGRNFILFLMIDMEPRMYAKPVVFYVFIIWSLVELVRYPYYLAQLLGREVGLLTW 278
            .|.:..||||:.|..|||::|..:..:.:|.:|..:|.:|:|.:::||||.:...:|.:...||.
 Frog    73 YSLLPTFFQVTERLIILFVVITSQEEVQSKYIVCALFFLWNLWDVIRYPYDMLAAVGIDYSALTR 137

  Fly   279 LRYTIWIPLYPMGILCEGIIVLRNIPYIEETKRFTVEMPNPWNITFDMVLFLKIYLMLLIIPGSY 343
            |::|.||..||:.:|.|...|..::||.|....::.:|.:|.:::|.....|.:||:..:: |.:
 Frog   138 LKHTWWILAYPLSVLAEAYTVYESLPYFESRGTYSFKMESPVSLSFHFPYILTLYLIFQLV-GMF 201

  Fly   344 LVMS---------HMAKLRSKK 356
            .:.|         ...||:.||
 Frog   202 YICSCQWWERKQYFRRKLKLKK 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hacd2NP_609655.2 p23_hB-ind1_like 6..114 CDD:107222
PTPLA 197..357 CDD:282269 53/169 (31%)
hacd4XP_017953281.1 PTPLA 56..217 CDD:398198 49/161 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1458293at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.