DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hacd2 and hacd1

DIOPT Version :9

Sequence 1:NP_609655.2 Gene:Hacd2 / 34762 FlyBaseID:FBgn0032524 Length:371 Species:Drosophila melanogaster
Sequence 2:XP_002939049.2 Gene:hacd1 / 100145048 XenbaseID:XB-GENE-957000 Length:240 Species:Xenopus tropicalis


Alignment Length:254 Identity:69/254 - (27%)
Similarity:119/254 - (46%) Gaps:34/254 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 TEDDVEVEEKPRDVRQDYEKEYADLQKRELGYIKEKTKK-------VYMIFYNLAMFVGYLYIMV 168
            ::|:..|||                        ||.|||       .::.|||:||..|:|.:.:
 Frog     4 SDDEGSVEE------------------------KEHTKKKIGPLATAWLTFYNIAMTAGWLVLAI 44

  Fly   169 VMGVLYYRDGVDSIGKTYANVGNAFKFIQLLQYLEVMHPMFGYTKGSPVVPFFQVSGRNFILFLM 233
            .|...|...|...  ..|.|:....||.|....||::|...|....|.:|...|||.|.|:::.:
 Frog    45 AMIRFYAEKGTHK--GLYRNIQKTLKFFQTFALLELVHCALGIVHTSVLVTGVQVSSRIFMVWFI 107

  Fly   234 IDMEPRMYAKPVVFYVFIIWSLVELVRYPYYLAQLLGREVGLLTWLRYTIWIPLYPMGILCEGII 298
            .....::.::..|....::|::.|:.||.||..:||......:.|.||.::|.|||:|::.|.:.
 Frog   108 TSSIKQVQSEHGVLIFLVVWTVTEITRYSYYTFKLLNHLPYFIKWARYNLFIVLYPVGVVGELLT 172

  Fly   299 VLRNIPYIEETKRFTVEMPNPWNITFDMVLFLKIYLMLLIIPGSYLVMSHMAKLRSKKL 357
            :...:|::.::..:::.:||.:|::||...|| |..|...||....:..||.:.|.:.|
 Frog   173 IYAALPHVRKSAMYSLRLPNKYNVSFDYYYFL-IIAMCSYIPLFPQLYFHMLRQRRRVL 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hacd2NP_609655.2 p23_hB-ind1_like 6..114 CDD:107222 0/2 (0%)
PTPLA 197..357 CDD:282269 45/159 (28%)
hacd1XP_002939049.2 PTPLA 71..230 CDD:367918 45/159 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1458293at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.