DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tehao and AT1G72890

DIOPT Version :10

Sequence 1:NP_477438.1 Gene:Tehao / 34761 FlyBaseID:FBgn0026760 Length:795 Species:Drosophila melanogaster
Sequence 2:NP_001185387.1 Gene:AT1G72890 / 843620 AraportID:AT1G72890 Length:487 Species:Arabidopsis thaliana


Alignment Length:215 Identity:45/215 - (20%)
Similarity:78/215 - (36%) Gaps:68/215 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   644 YDAFISYSHKD--EELISKLLPKLES-GPHPFRLCLHDRDWLVGDCIPEQIVRTVDDSKRVIIVL 705
            :|.|:|:..||  :..:|.|...|.| |...|:   .|.:...|..||.::.:.:..|:..::|:
plant    39 FDVFLSFRGKDTRKNFVSFLYKALVSKGIRTFK---DDEELERGRPIPPELRQAIKGSRIAVVVV 100

  Fly   706 SQHFIDSVWARMEFR---------------IAYQATLQDKRKRIIII-----------------L 738
            |..:..|.|...|.|               |.|:....|.|::..::                 .
plant   101 SVTYPASSWCLEELREILKLEKLGLLTVIPIFYEINPSDVRRQSGVVSKQFKKHEKRQSRERVKS 165

  Fly   739 YRE----LEHMNG--------IDSELRAYLKLNTYLKWGDPLFWS-----------------KLY 774
            :||    |..::|        :.:....:..|:.:|| |..|.:|                 ||:
plant   166 WREALTKLASLSGECSKNWEDLSNRFSKFRFLSLFLK-GLRLCFSREDDSKLVDGITEKISTKLF 229

  Fly   775 YAMPHNRRVLKGQKKHAGPL 794
            ...|.|..:|.|..:|.|.|
plant   230 SEKPRNDNILIGIDQHMGEL 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TehaoNP_477438.1 LRR 184..>541 CDD:443914
leucine-rich repeat 185..207 CDD:275380
leucine-rich repeat 209..232 CDD:275380
leucine-rich repeat 233..261 CDD:275380
leucine-rich repeat 262..284 CDD:275380
leucine-rich repeat 285..309 CDD:275380
leucine-rich repeat 310..333 CDD:275380
leucine-rich repeat 334..357 CDD:275380
leucine-rich repeat 358..381 CDD:275380
leucine-rich repeat 445..482 CDD:275380
leucine-rich repeat 483..505 CDD:275380
TIR 643..779 CDD:214587 38/198 (19%)
AT1G72890NP_001185387.1 PLN03210 39..>413 CDD:215633 45/215 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.