DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Tehao and AT1G60320

DIOPT Version :9

Sequence 1:	NP_001285901.1	Gene:	Tehao / 34761	FlyBaseID:	FBgn0026760	Length:	795	Species:	Drosophila melanogaster
Sequence 2:	NP_176236.1	Gene:	AT1G60320 / 842327	AraportID:	AT1G60320	Length:	171	Species:	Arabidopsis thaliana

Alignment Length:	141	Identity:	32/141 - (22%)
Similarity:	60/141 - (42%)	Gaps:	26/141 - (18%)

- Green bases have known domain annotations that are detailed below.

  Fly   647 FISYSHKDEELISKLLPKLESGPHPFRLCLH------DRDWLVGDCIPEQIVRTVDDSKRVIIVL 705
            ||::  :.||:....|..|.:.   |.  ||      |:|...|..: :.:.:.:..|:..:.:.
plant    27 FINF--RGEEIRYSFLSHLAAA---FE--LHGINFFIDKDEQKGKDL-KHLFKRIKQSQIALAIF 83

  Fly   706 SQHFIDSVWARMEFRIAYQATLQDKRK-RIIIILYR----ELEHMNG-IDSELRAYLKLNT---Y 761
            |:.:.:|.|...|  :|....|..|.| .::.|.|:    ::.|..| ..|......|:::   .
plant    84 SERYAESPWCLNE--LAKMKKLAKKGKLNVVPIFYKVEVNDVRHQEGKFGSNFWKLAKISSGDEI 146

  Fly   762 LKWGDPL-FWS 771
            .||.:.| |:|
plant   147 KKWKEALEFFS 157

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Tehao	NP_001285901.1	leucine-rich repeat	185..207	CDD:275380
		leucine-rich repeat	209..232	CDD:275380
		leucine-rich repeat	233..261	CDD:275380
		LRR_RI	<261..370	CDD:238064
		leucine-rich repeat	262..284	CDD:275380
		leucine-rich repeat	285..309	CDD:275380
		LRR_8	309..368	CDD:290566
		leucine-rich repeat	310..333	CDD:275380
		leucine-rich repeat	334..357	CDD:275380
		leucine-rich repeat	358..381	CDD:275380
		leucine-rich repeat	445..482	CDD:275380
		LRR_8	459..516	CDD:290566
		leucine-rich repeat	483..505	CDD:275380
		LRR_4	486..521	CDD:289563
		TIR	643..779	CDD:214587	32/141 (23%)
AT1G60320	NP_176236.1	TIR	23..159	CDD:214587	32/141 (23%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	1	1.000	44	1.000	Domainoid score	I4673
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D282372at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	2.010