DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Tehao and AT1G57830

DIOPT Version :9

Sequence 1:	NP_001285901.1	Gene:	Tehao / 34761	FlyBaseID:	FBgn0026760	Length:	795	Species:	Drosophila melanogaster
Sequence 2:	NP_176093.2	Gene:	AT1G57830 / 842158	AraportID:	AT1G57830	Length:	168	Species:	Arabidopsis thaliana

Alignment Length:	50	Identity:	12/50 - (24%)
Similarity:	25/50 - (50%)	Gaps:	1/50 - (2%)

- Green bases have known domain annotations that are detailed below.

  Fly   691 IVRTVDDSKRVIIVLSQHFIDSVWARMEFRIAYQATLQDKRKRIIIILYR 740
            :.:.:::||.|:.:.|..:..|.|...|.....:...::|.| :|.|.|:
plant    66 LFKRIEESKIVLAIFSGKYAQSKWCLNELATVKKLAEENKLK-VIPIFYK 114

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Tehao	NP_001285901.1	leucine-rich repeat	185..207	CDD:275380
		leucine-rich repeat	209..232	CDD:275380
		leucine-rich repeat	233..261	CDD:275380
		LRR_RI	<261..370	CDD:238064
		leucine-rich repeat	262..284	CDD:275380
		leucine-rich repeat	285..309	CDD:275380
		LRR_8	309..368	CDD:290566
		leucine-rich repeat	310..333	CDD:275380
		leucine-rich repeat	334..357	CDD:275380
		leucine-rich repeat	358..381	CDD:275380
		leucine-rich repeat	445..482	CDD:275380
		LRR_8	459..516	CDD:290566
		leucine-rich repeat	483..505	CDD:275380
		LRR_4	486..521	CDD:289563
		TIR	643..779	CDD:214587	12/49 (24%)
AT1G57830	NP_176093.2	None
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	1	1.000	44	1.000	Domainoid score	I4673
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D282372at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	2.010