DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tehao and AT4G09430

DIOPT Version :10

Sequence 1:NP_477438.1 Gene:Tehao / 34761 FlyBaseID:FBgn0026760 Length:795 Species:Drosophila melanogaster
Sequence 2:NP_001319887.1 Gene:AT4G09430 / 826526 AraportID:AT4G09430 Length:555 Species:Arabidopsis thaliana


Alignment Length:132 Identity:35/132 - (26%)
Similarity:63/132 - (47%) Gaps:14/132 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   642 KTYDAFISYSHKD--EELISKLLPKL-ESGPHPFRLCLHDRDWLVGDCIPEQIVRTVDDSKRVII 703
            |.||.|:|:...|  ..::|.|...| :.|...|:   .|::...||.|.|::|..:..|...::
plant    13 KEYDVFLSFRGADTRNNIVSYLHKALVDVGIRTFK---DDKELEEGDIISEKLVNAIQTSWFAVV 74

  Fly   704 VLSQHFIDSVWARMEFRIAYQATLQDKRKRIIIILYRELE------HMNGIDSELRAYLKLNTYL 762
            |||:.::.|.|...|.|...:.::||  ..|::.::.::|      ..|..:.:|:.|......|
plant    75 VLSEKYVTSSWCLEELRHIMELSIQD--DIIVVPIFYKVEPSDVRYQKNSFEVKLQHYRDPEKIL 137

  Fly   763 KW 764
            ||
plant   138 KW 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TehaoNP_477438.1 LRR 184..>541 CDD:443914
leucine-rich repeat 185..207 CDD:275380
leucine-rich repeat 209..232 CDD:275380
leucine-rich repeat 233..261 CDD:275380
leucine-rich repeat 262..284 CDD:275380
leucine-rich repeat 285..309 CDD:275380
leucine-rich repeat 310..333 CDD:275380
leucine-rich repeat 334..357 CDD:275380
leucine-rich repeat 358..381 CDD:275380
leucine-rich repeat 445..482 CDD:275380
leucine-rich repeat 483..505 CDD:275380
TIR 643..779 CDD:214587 34/131 (26%)
AT4G09430NP_001319887.1 PLN03210 1..>544 CDD:215633 35/132 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.