DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tehao and Tlr12

DIOPT Version :9

Sequence 1:NP_001285901.1 Gene:Tehao / 34761 FlyBaseID:FBgn0026760 Length:795 Species:Drosophila melanogaster
Sequence 2:NP_001102152.1 Gene:Tlr12 / 362604 RGDID:1559145 Length:904 Species:Rattus norvegicus


Alignment Length:849 Identity:181/849 - (21%)
Similarity:296/849 - (34%) Gaps:229/849 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 PDEYAMLLEVSE-----PGASLYMSYYASTELQWLPRFNISSLVKIEFDAYIFWPEKFLSDLLKT 111
            ||.:..|:.:..     |..:........:.|||| ...||.|......|.||      .||::.
  Rat   136 PDAFGDLISLQRLHFCGPCLNKKAGVRLPSSLQWL-SVTISCLQDSGELAGIF------PDLVQN 193

  Fly   112 LGVQTVKTIIFRDRTLETVVTRDVLNSGNGYMETSQPENI----TTWHFGSVPGLKKFKFFSHVP 172
            ...:...|:    :.|:..:.:.:..:..|.::..|.|.:    |....|:|.||          
  Rat   194 SSSRASWTL----KKLDLSLNQKLKMATPGSLQGLQVEILDLRKTQLDAGAVKGL---------- 244

  Fly   173 ELQESIFHGFDTLRDLHLSVNVTTLPGNMLSTVNGTLKTLTIESPGIVSFGNPLLRELQQLRNLS 237
                    |...|..|:.......|...  :..:..|:.|.::...|.:.....|.....|..||
  Rat   245 --------GLQKLNVLYAPTATAELAAE--TAAHFELQGLNVDRSKIGNISQEALASCHSLETLS 299

  Fly   238 LALIHPFHERD---KQLQPHFFGSMTNLEEVRLASATSSVNRSMFKGTNKLQ--LIKMNGNDDLM 297
            |:        |   .:|.|.|..:|..|..:.||.             |:||  ::.||...|:.
  Rat   300 LS--------DTGLTKLPPGFLAAMPRLRRLNLAG-------------NQLQSTMLCMNETGDVS 343

  Fly   298 ELPGEIFLDQVNLKTLDLSCNAIVTLHEDVFKGLGNLTLLDLSKNRLTNLSSTIFAPLTSLNVLR 362
                       .|.|||||.|.:..|....|..|.:|..|.|..|:|.:|....|..|..|..|:
  Rat   344 -----------GLSTLDLSGNGLRILPPATFSCLPHLRELLLQDNQLLSLEGHPFQDLQQLETLK 397

  Fly   363 LNKNSLTAMSPSVFQDVVSLNYIEMVNTQ--------FYGATLL---------MNYEAVVCTNDE 410
            |::|.|..:..:....:.:|..:.:::||        |:||..|         ::..||:..   
  Rat   398 LDRNPLLNLGKNCLAALPALTTLSLLDTQILHSPDAGFWGARSLHTLHLSLPPLSAPAVLSL--- 459

  Fly   411 ACQYKSAEWQCDPRCICWVQRSVGSLIVDCRGTSLEELPDLPRTTLLSTVLKVGNNSLTSLPTVS 475
            .....|.|....|....|.             .|....|.|...|:....||:|..:.:.:....
  Rat   460 PMYLTSLELHVTPGLKHWT-------------LSPNIFPFLETLTINGRGLKLGVQNASEVFPAL 511

  Fly   476 EHSGYANVSGLFLSDNNLTSLGSGD-------QLPDNLTHLDVRG-------------NQIQSLS 520
            :|        |||..|:|.:..|.|       ||| .|..|.|.|             ..:|.|.
  Rat   512 QH--------LFLLQNSLDAFCSQDASSIFLWQLP-KLQSLKVWGAGSNSRPCLITGLPSLQELK 567

  Fly   521 DEFLLFLQEPNNTMTLSLSGN-P-------ITCGCESLSLLFFVRT------------------- 558
            .|.|..:.:|.:.....|.|: |       .:.|.:|||...|.|.                   
  Rat   568 LESLQSITQPRSVQLEELVGDLPQLQALQLSSTGLKSLSAAAFRRLHSLQALVLDSEKDLVLQDS 632

  Fly   559 ----NPQRVRDI----ADIVC----------TKQK-KSFQQMEAFELCPSYV------------- 591
                :||..|.:    :.:.|          .||. |::..:....|||..|             
  Rat   633 LREYSPQMPRYVYILQSKLACQCANAWMELWVKQSTKTYVHIRDGHLCPGEVRVPARDSLISFLW 697

  Fly   592 --------LLISCVVGGLVIVICLLTVFYLMFQQELKIWL-YNNNLCLWWV----SEEELDKDKT 643
                    |.:......||:::.:|.    :.|.....|: |...|...|:    .:....|...
  Rat   698 DHCPQTLELKLFLASSALVLLLIVLP----LLQGARNTWIPYLRALFRIWLQGLRGQGNAGKRFL 758

  Fly   644 YDAFISYSHKDEE-LISKLLPKLESGPHP----FRLCLHDRDWLVGDCIPEQIVRTVDDSKRVII 703
            :|.|:|:..:|:. ::.:|||.|| |..|    .||||.:||:..|..:.:.:|.::..|:..:.
  Rat   759 FDVFVSHCRQDQGWVLEELLPALE-GFLPAGLGLRLCLPERDFEPGKDVVDNVVDSMVSSRVTLC 822

  Fly   704 VLSQHFIDSVWARMEFRIAYQATLQDKRKRIIIILYRE--LEHMNGIDSELRAYLKLNTYLKWGD 766
            |||...:.:....:|.|:|....|......::::::.|  ..|      :|.:|.:|...|:.||
  Rat   823 VLSGPALCNPRCCLELRLATSLLLAAPSPPVLLLVFLEPISRH------QLPSYHRLARLLRRGD 881

  Fly   767 PLFW 770
            ...|
  Rat   882 YCLW 885

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TehaoNP_001285901.1 leucine-rich repeat 185..207 CDD:275380 3/21 (14%)
leucine-rich repeat 209..232 CDD:275380 4/22 (18%)
leucine-rich repeat 233..261 CDD:275380 9/30 (30%)
LRR_RI <261..370 CDD:238064 32/110 (29%)
leucine-rich repeat 262..284 CDD:275380 3/21 (14%)
leucine-rich repeat 285..309 CDD:275380 5/25 (20%)
LRR_8 309..368 CDD:290566 22/58 (38%)
leucine-rich repeat 310..333 CDD:275380 10/22 (45%)
leucine-rich repeat 334..357 CDD:275380 8/22 (36%)
leucine-rich repeat 358..381 CDD:275380 5/22 (23%)
leucine-rich repeat 445..482 CDD:275380 7/36 (19%)
LRR_8 459..516 CDD:290566 18/76 (24%)
leucine-rich repeat 483..505 CDD:275380 10/28 (36%)
LRR_4 486..521 CDD:289563 16/54 (30%)
TIR 643..779 CDD:214587 36/135 (27%)
Tlr12NP_001102152.1 leucine-rich repeat 71..93 CDD:275380
leucine-rich repeat 94..116 CDD:275380
leucine-rich repeat 117..144 CDD:275380 3/7 (43%)
leucine-rich repeat 202..225 CDD:275380 2/26 (8%)
leucine-rich repeat 226..270 CDD:275380 10/63 (16%)
leucine-rich repeat 246..259 CDD:275381 2/12 (17%)
LRR_8 270..329 CDD:290566 17/79 (22%)
leucine-rich repeat 271..294 CDD:275380 4/22 (18%)
LRR_4 294..331 CDD:289563 14/57 (25%)
leucine-rich repeat 295..318 CDD:275380 9/30 (30%)
leucine-rich repeat 319..344 CDD:275380 9/48 (19%)
LRR_8 343..403 CDD:290566 22/70 (31%)
LRR_RI 345..547 CDD:238064 57/226 (25%)
leucine-rich repeat 345..368 CDD:275380 10/22 (45%)
leucine-rich repeat 369..392 CDD:275380 8/22 (36%)
leucine-rich repeat 393..416 CDD:275380 5/22 (23%)
leucine-rich repeat 417..437 CDD:275380 4/19 (21%)
leucine-rich repeat 441..510 CDD:275380 14/84 (17%)
leucine-rich repeat 511..562 CDD:275380 15/59 (25%)
leucine-rich repeat 563..591 CDD:275380 7/27 (26%)
leucine-rich repeat 592..615 CDD:275380 6/22 (27%)
TIR 759..900 CDD:214587 36/134 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D147327at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24365
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.