DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tehao and IL1RAPL2

DIOPT Version :9

Sequence 1:NP_001285901.1 Gene:Tehao / 34761 FlyBaseID:FBgn0026760 Length:795 Species:Drosophila melanogaster
Sequence 2:NP_059112.1 Gene:IL1RAPL2 / 26280 HGNCID:5997 Length:686 Species:Homo sapiens


Alignment Length:243 Identity:56/243 - (23%)
Similarity:116/243 - (47%) Gaps:31/243 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   565 DIADIVCTKQKKSFQQMEAFELCPS---YVLLISCVVGGLVIVICLLTVFYLMFQQELKIWLYNN 626
            |:|:..|..:.::.::..:..|...   |.:.::..:|.:.:::.||.|.|..:..||.:: |..
Human   325 DLANYTCHVENRNGRKHASVLLRKKDLIYKIELAGGLGAIFLLLVLLVVIYKCYNIELMLF-YRQ 388

  Fly   627 NLCLWWVSEEELDKDKTYDAFISYSHKDEELIS-----------KLLPKLESGPHPFRLCLHDRD 680
            :    :.::|..|.:|.|||::||:..|::.:.           ::||.:....:.::|.:.:||
Human   389 H----FGADETNDDNKEYDAYLSYTKVDQDTLDCDNPEEEQFALEVLPDVLEKHYGYKLFIPERD 449

  Fly   681 WLVGDCIPEQIVRTVDDSKRVIIVLSQHFI-DSVWARMEFRIAYQATLQDKRKRIIIILYRELE- 743
            .:......|.:.|.|:.|:|:||||:..:| ...|:..|........|.....::|:|...||: 
Human   450 LIPSGTYMEDLTRYVEQSRRLIIVLTPDYILRRGWSIFELESRLHNMLVSGEIKVILIECTELKG 514

  Fly   744 --HMNGIDSELRAYLKLNTYLKWG-------DPLFWSKLYYAMPHNRR 782
              :...::| |:..:||.:.:||.       :..||..|.|.||..::
Human   515 KVNCQEVES-LKRSIKLLSLIKWKGSKSSKLNSKFWKHLVYEMPIKKK 561

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TehaoNP_001285901.1 leucine-rich repeat 185..207 CDD:275380
leucine-rich repeat 209..232 CDD:275380
leucine-rich repeat 233..261 CDD:275380
LRR_RI <261..370 CDD:238064
leucine-rich repeat 262..284 CDD:275380
leucine-rich repeat 285..309 CDD:275380
LRR_8 309..368 CDD:290566
leucine-rich repeat 310..333 CDD:275380
leucine-rich repeat 334..357 CDD:275380
leucine-rich repeat 358..381 CDD:275380
leucine-rich repeat 445..482 CDD:275380
LRR_8 459..516 CDD:290566
leucine-rich repeat 483..505 CDD:275380
LRR_4 486..521 CDD:289563
TIR 643..779 CDD:214587 39/157 (25%)
IL1RAPL2NP_059112.1 Ig 32..133 CDD:325142
Ig2_IL1R_like 146..237 CDD:319309
IG_like 250..347 CDD:214653 3/21 (14%)
TIR 402..563 CDD:307630 40/161 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S8062
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.