Sequence 1: | NP_001285901.1 | Gene: | Tehao / 34761 | FlyBaseID: | FBgn0026760 | Length: | 795 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_059112.1 | Gene: | IL1RAPL2 / 26280 | HGNCID: | 5997 | Length: | 686 | Species: | Homo sapiens |
Alignment Length: | 243 | Identity: | 56/243 - (23%) |
---|---|---|---|
Similarity: | 116/243 - (47%) | Gaps: | 31/243 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 565 DIADIVCTKQKKSFQQMEAFELCPS---YVLLISCVVGGLVIVICLLTVFYLMFQQELKIWLYNN 626
Fly 627 NLCLWWVSEEELDKDKTYDAFISYSHKDEELIS-----------KLLPKLESGPHPFRLCLHDRD 680
Fly 681 WLVGDCIPEQIVRTVDDSKRVIIVLSQHFI-DSVWARMEFRIAYQATLQDKRKRIIIILYRELE- 743
Fly 744 --HMNGIDSELRAYLKLNTYLKWG-------DPLFWSKLYYAMPHNRR 782 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Tehao | NP_001285901.1 | leucine-rich repeat | 185..207 | CDD:275380 | |
leucine-rich repeat | 209..232 | CDD:275380 | |||
leucine-rich repeat | 233..261 | CDD:275380 | |||
LRR_RI | <261..370 | CDD:238064 | |||
leucine-rich repeat | 262..284 | CDD:275380 | |||
leucine-rich repeat | 285..309 | CDD:275380 | |||
LRR_8 | 309..368 | CDD:290566 | |||
leucine-rich repeat | 310..333 | CDD:275380 | |||
leucine-rich repeat | 334..357 | CDD:275380 | |||
leucine-rich repeat | 358..381 | CDD:275380 | |||
leucine-rich repeat | 445..482 | CDD:275380 | |||
LRR_8 | 459..516 | CDD:290566 | |||
leucine-rich repeat | 483..505 | CDD:275380 | |||
LRR_4 | 486..521 | CDD:289563 | |||
TIR | 643..779 | CDD:214587 | 39/157 (25%) | ||
IL1RAPL2 | NP_059112.1 | Ig | 32..133 | CDD:325142 | |
Ig2_IL1R_like | 146..237 | CDD:319309 | |||
IG_like | 250..347 | CDD:214653 | 3/21 (14%) | ||
TIR | 402..563 | CDD:307630 | 40/161 (25%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 1 | 0.950 | - | 0 | Normalized mean entropy | S8062 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.860 |