DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tehao and tlrs5

DIOPT Version :9

Sequence 1:NP_001285901.1 Gene:Tehao / 34761 FlyBaseID:FBgn0026760 Length:795 Species:Drosophila melanogaster
Sequence 2:XP_002937550.2 Gene:tlrs5 / 100489423 XenbaseID:XB-GENE-22201327 Length:653 Species:Xenopus tropicalis


Alignment Length:548 Identity:125/548 - (22%)
Similarity:196/548 - (35%) Gaps:177/548 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 QIIPLPTFCLGLSPQCTCAAEGNVVRFHCPDEYAMLLEVSEPGASLYMSYYASTELQW--LPR-- 83
            ::.|.||| |.||.......:.|.|...|.::...|     .|..|.:...:|..||.  .|.  
 Frog   170 RVRPDPTF-LKLSSISFLLLKFNKVSMLCGEDLQNL-----QGRRLQLLDMSSNPLQLSSTPHCT 228

  Fly    84 --FNISSLVKIEFDAYIFWPEKFLSDLLKTLGVQTVKTIIFRDRTLETVVTRDVLNSGNGYMETS 146
              ||..:|..::..: :.|..:.:.:.::|:....|..|..|...        .|.||.|:....
 Frog   229 NPFNNITLGTLDVSS-MGWNAEMVENFVRTISGTQVDYIKMRHTA--------GLGSGFGFHNLK 284

  Fly   147 QPENITTWHFGSVPGLKKFK---------FFSH-VPELQESIFHGFDTLRDLHLSVN-------- 193
            .|...|      ..||....         |.|| ||:|    |..|..|..|.||.|        
 Frog   285 DPNKDT------FSGLNSSNVQILDLSNGFISHLVPQL----FSAFPKLLSLDLSSNQINRMSSG 339

  Fly   194 ---------VTTLPGNMLSTVNG---------TLKTLTIESP--GIVSFGNPLLRELQQLRNLSL 238
                     ...|.||:|..:.|         :||||.:.|.  |.|.:|  .|.....|.:|:|
 Frog   340 AFSGLGELVSLNLSGNLLGELMGSSFQGLGATSLKTLDLSSNHIGAVQYG--ALDSFTALTSLNL 402

  Fly   239 ALIHPFHERDKQLQ------------------------------PHF------------FGSMTN 261
                    ||..|.                              ||.            |.|:..
 Frog   403 --------RDNALNKIPPTKLQGVTFVLLKQNRISDIYNIISFCPHATILDLSSNRLTDFRSLWQ 459

  Fly   262 LEEVR----LASATSSVNRSMFKGTNKLQ----LIKMNGNDDLMELP-------GEIFLDQVNLK 311
            :.|::    |:.|::|:.|.....|:.:.    |:.::.:|:.:. |       |:||:...:||
 Frog   460 ILELQSLKYLSLASNSLYRCSLPHTSNITRTSGLVYLDLSDNALG-PVLKSGECGDIFMHLGSLK 523

  Fly   312 TLDLSCNAIVTLHEDVFKGLGNLTLLDLSKNRLTNLSSTIFAPLTSLNVLRLNKNSLTAMSPSVF 376
            :|:|:.|.:..:.:.:|:.|.:|..||||.|....:.|.:|..||:|..|.|.|::|..:|.||.
 Frog   524 SLNLARNQLSNIPDTMFRSLSSLQTLDLSGNGFKEIQSNLFTGLTALKTLNLGKSNLVTLSSSVL 588

  Fly   377 QDVVSLNYIEMVNTQFYGATLLMNYEAVVCTNDEACQYKSAEWQCDPRCICW----------VQR 431
            ..:.||..|::..     .||:                      ||  |..|          |..
 Frog   589 DPLGSLESIDLSE-----VTLV----------------------CD--CSLWDFWKWLEDTNVTV 624

  Fly   432 SVGSLIVDCRGTSLEELPDLPRTTLLST 459
            :||...|.|...: ..:|::|..|.|.:
 Frog   625 NVGKQEVLCIQPT-PRIPEIPLATFLKS 651

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TehaoNP_001285901.1 leucine-rich repeat 185..207 CDD:275380 9/38 (24%)
leucine-rich repeat 209..232 CDD:275380 9/24 (38%)
leucine-rich repeat 233..261 CDD:275380 10/69 (14%)
LRR_RI <261..370 CDD:238064 34/123 (28%)
leucine-rich repeat 262..284 CDD:275380 6/25 (24%)
leucine-rich repeat 285..309 CDD:275380 6/34 (18%)
LRR_8 309..368 CDD:290566 21/58 (36%)
leucine-rich repeat 310..333 CDD:275380 7/22 (32%)
leucine-rich repeat 334..357 CDD:275380 9/22 (41%)
leucine-rich repeat 358..381 CDD:275380 8/22 (36%)
leucine-rich repeat 445..482 CDD:275380 4/15 (27%)
LRR_8 459..516 CDD:290566 0/1 (0%)
leucine-rich repeat 483..505 CDD:275380
LRR_4 486..521 CDD:289563
TIR 643..779 CDD:214587
tlrs5XP_002937550.2 PLN00113 100..>597 CDD:215061 109/462 (24%)
leucine-rich repeat 108..131 CDD:275380
leucine-rich repeat 132..157 CDD:275380
leucine-rich repeat 158..182 CDD:275380 6/12 (50%)
leucine-rich repeat 183..208 CDD:275380 5/29 (17%)
leucine-rich repeat 209..232 CDD:275380 5/22 (23%)
leucine-rich repeat 299..322 CDD:275380 8/26 (31%)
leucine-rich repeat 323..346 CDD:275380 5/22 (23%)
leucine-rich repeat 347..372 CDD:275380 5/24 (21%)
leucine-rich repeat 373..396 CDD:275380 9/24 (38%)
leucine-rich repeat 397..440 CDD:275380 6/50 (12%)
leucine-rich repeat 418..431 CDD:275378 0/12 (0%)
leucine-rich repeat 441..492 CDD:275380 8/50 (16%)
leucine-rich repeat 493..521 CDD:275380 6/28 (21%)
leucine-rich repeat 522..545 CDD:275380 7/22 (32%)
leucine-rich repeat 546..569 CDD:275380 9/22 (41%)
leucine-rich repeat 570..591 CDD:275380 8/20 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D147327at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.