DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10859 and FY

DIOPT Version :9

Sequence 1:NP_001285898.1 Gene:CG10859 / 34756 FlyBaseID:FBgn0032520 Length:627 Species:Drosophila melanogaster
Sequence 2:NP_001318555.1 Gene:FY / 831191 AraportID:AT5G13480 Length:657 Species:Arabidopsis thaliana


Alignment Length:367 Identity:73/367 - (19%)
Similarity:127/367 - (34%) Gaps:111/367 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 SMKIAARGTH---------VFHDLWIPS-RRLMTCEWLNNDPNQFLLFYSNRMSLTPDYTKQLNT 203
            |...||:..|         :...||.|| |||:|    .:...:|.|:  |..|...:...|   
plant   118 STSFAAKFVHASLNKNRCSINRVLWTPSGRRLIT----GSQSGEFTLW--NGQSFNFEMILQ--- 173

  Fly   204 LPDFGNDNPHAFYIWNLDDATRPAAHYDSRRVVRVAKVCLRDESYMVGGLQEGQVGFWLTENQGG 268
                .:|.|....:|:                        .:|:|||.|...|.:.:|    |..
plant   174 ----AHDQPIRSMVWS------------------------HNENYMVSGDDGGTLKYW----QNN 206

  Fly   269 PKSMCPLEACHREATTAICWVHSKLNTEFYSGSLDGSIKYWDTRDLLMPVHEVLAEPDPQTVQNR 333
            ..::...:..|:|:...:.:  .|.:.:|.|.|.|.::|.||....:          |..::   
plant   207 MNNVKANKTAHKESIRDLSF--CKTDLKFCSCSDDTTVKVWDFTKCV----------DESSL--- 256

  Fly   334 QDAHG--VTFLEFEYTIPVRFIFCTDMGYLFVGNRKGTTPQDTIVAAYQLFAGPIRCVMRNPFFV 396
             ..||  |..:::..|           ..|.|...|     |.:|..:...:|...|.:...   
plant   257 -TGHGWDVKSVDWHPT-----------KSLLVSGGK-----DQLVKLWDTRSGRELCSLHGH--- 301

  Fly   397 KNFLVV------GDWRVRIWSEEV---------KNCPSTFYFR-RPNQLLSGAWSTGRCSLFCIG 445
            ||.::.      |:|.:....:::         |...|   || ....:.|.||.......|..|
plant   302 KNIVLSVKWNQNGNWLLTASKDQIIKLYDIRTMKELQS---FRGHTKDVTSLAWHPCHEEYFVSG 363

  Fly   446 DNMGNLEFWDLLMSHKRPILTI--KYKYAVTHLVFKPDGTML 485
            .:.|::..|  ::.|:.|.:.|  .:..:|..|.:.|.|.:|
plant   364 SSDGSICHW--IVGHENPQIEIPNAHDNSVWDLAWHPIGYLL 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10859NP_001285898.1 WD40 <245..310 CDD:295369 16/64 (25%)
WD40 261..>512 CDD:225201 47/245 (19%)
WD40 279..492 CDD:295369 45/227 (20%)
WD40 repeat 284..332 CDD:293791 9/47 (19%)
WD40 repeat 386..422 CDD:293791 7/50 (14%)
WD40 repeat 429..454 CDD:293791 6/24 (25%)
FYNP_001318555.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.