DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10859 and dnai1.1

DIOPT Version :9

Sequence 1:NP_001285898.1 Gene:CG10859 / 34756 FlyBaseID:FBgn0032520 Length:627 Species:Drosophila melanogaster
Sequence 2:XP_021324725.1 Gene:dnai1.1 / 570363 ZFINID:ZDB-GENE-040910-7 Length:105 Species:Danio rerio


Alignment Length:87 Identity:22/87 - (25%)
Similarity:34/87 - (39%) Gaps:16/87 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   508 NKEKSLMMS---MFEREIQRCKLLEAREEEIKLKKRLTTIFL-----------EEERKSREKLEA 558
            ||..||.:|   :|:..|.|.:.| .::..:..|:.||.|..           :..|....||..
Zfish     9 NKAPSLFVSQVHVFDLSINRFEAL-CQQRVVSTKRHLTCIEFNPVHPIIIVGNDRGRVISLKLSP 72

  Fly   559 K-KKKGQAKKEMEPKVEDEATI 579
            . :|..:.:|..||....|..|
Zfish    73 NLRKNPKEEKGKEPSTGAEVEI 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10859NP_001285898.1 WD40 <245..310 CDD:295369
WD40 261..>512 CDD:225201 2/3 (67%)
WD40 279..492 CDD:295369
WD40 repeat 284..332 CDD:293791
WD40 repeat 386..422 CDD:293791
WD40 repeat 429..454 CDD:293791
dnai1.1XP_021324725.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.