DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10859 and DYNC2I1

DIOPT Version :9

Sequence 1:NP_001285898.1 Gene:CG10859 / 34756 FlyBaseID:FBgn0032520 Length:627 Species:Drosophila melanogaster
Sequence 2:XP_006716104.1 Gene:DYNC2I1 / 55112 HGNCID:21862 Length:1069 Species:Homo sapiens


Alignment Length:630 Identity:135/630 - (21%)
Similarity:211/630 - (33%) Gaps:194/630 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 NEMILSVQPSGRLRLK--YILRNPIN-ERTQLSEQYAASSVLTHN---VTLDSHGLNHYEGGWNV 85
            ||..:.::..|:...|  |:..|..| ||...:|:.....|.|.:   .|:.|.|....:    .
Human   517 NEYDMYIRNFGKKNTKQAYVQCNEDNVERDIQTEEIETREVWTQHPGESTVVSGGSEQRD----T 577

  Fly    86 KEVNIMDEESTMRY----------------RKKVERDDSWGIEVNQLMHAAMDISSANNAVNIYE 134
            .:..:|.:..|.|.                ..::..:.||.:....   .|:..|.:::.:|   
Human   578 SDAVVMPKIDTPRLCSFLRAACQVMAVLLEEDRLAAEPSWNLRAQD---RALYFSDSSSQLN--- 636

  Fly   135 DFFVDLPEDLGRGIS----MKIAARGTHVFHDL----WIP--SRRLMTCEWLNNDPN--QFLLFY 187
               ..||....|.:|    .::..:.....|||    ::|  ..:.:.|.|....|:  |.:|..
Human   637 ---TSLPFLQNRKVSSLHTSRVQRQMVVSVHDLPEKSFVPLLDSKYVLCVWDIWQPSGPQKVLIC 698

  Fly   188 SNRMS---LTPDYTKQLNTLPDFGNDNPHAFYIWNLDDATRPAAHYDSRRVVRVAKVCLRDESYM 249
            .::::   |:|     |.....|......:..:|:|.:.:|  .||         .|.|.|    
Human   699 ESQVTCCCLSP-----LKAFLLFAGTAHGSVVVWDLREDSR--LHY---------SVTLSD---- 743

  Fly   250 VGGLQEGQVGFW----LTENQGG----PKSMCPLEACHREATTAICWVHSK-------LNTE--- 296
                     |||    .|.:..|    .....||:|....:|:    ||.|       .:|:   
Human   744 ---------GFWTFRTATFSTDGILTSVNHRSPLQAVEPISTS----VHKKQSFVLSPFSTQEEM 795

  Fly   297 ----FYSGSLD--GSIKYWDTRDL-------------LMP------VHEVLAEPDPQTVQNRQDA 336
                |:..|||  |.:..|...:|             |||      ||..|.:..........:.
Human   796 SGLSFHIASLDESGVLNVWVVVELPKADIAGSISDLGLMPGGRVKLVHSALIQLGDSLSHKGNEF 860

  Fly   337 HGVT---FLEFEYTIPVRFIFCTDMGYLFVGNRKGTTPQDTIVAAYQLFAGP---IRCVMRN--- 392
            .|.|   .::|..:.|..||..||||.:..|.|     ||..||. :||...   ||.|..|   
Human   861 WGTTQTLNVKFLPSDPNHFIIGTDMGLISHGTR-----QDLRVAP-KLFKPQQHGIRPVKVNVID 919

  Fly   393 --PFFVKNFLV-VGDWRVRI-----------WSEEVKNCPSTFYFRRPNQLLSG-AWSTGRCSLF 442
              ||....||. ..|..:|:           |....           .:..::| .||..|.::|
Human   920 FSPFGEPIFLAGCSDGSIRLHQLSSAFPLLQWDSST-----------DSHAVTGLQWSPTRPAVF 973

  Fly   443 CIGDNMGNLEFWDLLMSHKRPILTIKYKYAVTHLVF--------KPDGTMLTVSLANGDCLMLRL 499
            .:.|:..|:..||||.|...|:  .|.:.:...||.        |..|:.|.:.||..       
Human   974 LVQDDTSNIYIWDLLQSDLGPV--AKQQVSPNRLVAMAAVGEPEKAGGSFLALVLARA------- 1029

  Fly   500 EEGMRSATNKEKSLMMSMFEREIQRCK-----LLEAREEEIKLKK 539
                 |.:...:.|.......|:..|.     |.||...|.||.|
Human  1030 -----SGSIDIQHLKRRWAAPEVDECNRLRLLLQEALWPEGKLHK 1069

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10859NP_001285898.1 WD40 <245..310 CDD:295369 19/88 (22%)
WD40 261..>512 CDD:225201 75/325 (23%)
WD40 279..492 CDD:295369 68/279 (24%)
WD40 repeat 284..332 CDD:293791 17/82 (21%)
WD40 repeat 386..422 CDD:293791 11/52 (21%)
WD40 repeat 429..454 CDD:293791 7/25 (28%)
DYNC2I1XP_006716104.1 WD40 630..1020 CDD:225201 98/447 (22%)
WD40 repeat 648..676 CDD:293791 5/27 (19%)
WD40 repeat 736..778 CDD:293791 14/67 (21%)
WD40 repeat 785..814 CDD:293791 6/28 (21%)
WD40 repeat 829..860 CDD:293791 6/30 (20%)
WD40 <915..987 CDD:295369 16/82 (20%)
WD40 repeat 916..952 CDD:293791 7/35 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.