DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10859 and sw

DIOPT Version :9

Sequence 1:NP_001285898.1 Gene:CG10859 / 34756 FlyBaseID:FBgn0032520 Length:627 Species:Drosophila melanogaster
Sequence 2:NP_477075.2 Gene:sw / 44160 FlyBaseID:FBgn0003654 Length:663 Species:Drosophila melanogaster


Alignment Length:477 Identity:100/477 - (20%)
Similarity:180/477 - (37%) Gaps:81/477 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 KEVNIMDEESTMRYRKKV----ERDDSWGIEVNQLMHAAMDISSANNAVNIYEDFFVDLPEDLGR 146
            ||||.:.||     :|::    |....:.:...:::..|:   |.|  |:||.|:       :|.
  Fly   237 KEVNELSEE-----QKQMIILSENFQRFVVRAGRVIERAL---SEN--VDIYTDY-------IGG 284

  Fly   147 GISMKIAARGTH-------VFHD-LWIPSRRLMTCEWLNNDPNQFLLFYSNRMSLTPDYTKQLNT 203
            |.|.:.....:|       ||:| .|..:|.:.:.:|..:.|...:..|.|.             
  Fly   285 GDSEEANDERSHARLSLNRVFYDERWSKNRCITSMDWSTHFPELVVGSYHNN------------- 336

  Fly   204 LPDFGNDNPHAFYIWNL---DDATRPAAHYDSRRVVRVAKVCLR--DESYMVGGLQEGQVGFWLT 263
             .:..|:......:||.   ........|..|    .|...|..  :.:.::||...||:..|..
  Fly   337 -EESPNEPDGVVMVWNTKFKKSTPEDVFHCQS----AVMSTCFAKFNPNLILGGTYSGQIVLWDN 396

  Fly   264 ENQ-GGPKSMCPLE-ACHREATTAICWVHSKLNTEFYSGSLDGSIKYWDTRDLLMPVHEVLAEP- 325
            ..| ..|....||. |.|......:..|.::......|.|.||.:..|..        ::|::| 
  Fly   397 RVQKRTPIQRTPLSAAAHTHPVYCLQMVGTQNAHNVISISSDGKLCSWSL--------DMLSQPQ 453

  Fly   326 DPQTVQNRQD-AHGVTFLEFEYTIPVRFIFCTDMGYLFVGNRKGTTPQDTIVAAYQLFAGPIRCV 389
            |...:|.||. |..:|.:.|........:..::.||::..:|.|.  :..:...|:...|||..:
  Fly   454 DTLELQQRQSKAIAITSMAFPANEINSLVMGSEDGYVYSASRHGL--RSGVNEVYERHLGPITGI 516

  Fly   390 -----MRNPFFVKNFLVVG-DWRVRIWSEEVKNCPSTFYFR-RPNQLLSGAWSTGRCSLFCIGDN 447
                 ..:|.|...||... ||.:::||  :|:....:.|. ..:.::..|||....:||...|.
  Fly   517 STHYNQLSPDFGHLFLTSSIDWTIKLWS--LKDTKPLYSFEDNSDYVMDVAWSPVHPALFAAVDG 579

  Fly   448 MGNLEFWDLLMSHKRPI--LTIKYKYAVTHLVFKPDGTMLTVSLANGDCLMLRLEEGMRSATNKE 510
            .|.|:.|:|....:.|.  :.:....|:..:.:.|.|..:.:....|...:..:.|.:...:..|
  Fly   580 SGRLDLWNLNQDTEVPTASIVVAGAPALNRVSWTPSGLHVCIGDEAGKLYVYDVAENLAQPSRDE 644

  Fly   511 KSLMMSMFEREIQRCKLLEARE 532
                .|.|...:...|:.::.|
  Fly   645 ----WSRFNTHLSEIKMNQSDE 662

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10859NP_001285898.1 WD40 <245..310 CDD:295369 16/66 (24%)
WD40 261..>512 CDD:225201 57/263 (22%)
WD40 279..492 CDD:295369 48/223 (22%)
WD40 repeat 284..332 CDD:293791 9/48 (19%)
WD40 repeat 386..422 CDD:293791 10/41 (24%)
WD40 repeat 429..454 CDD:293791 8/24 (33%)
swNP_477075.2 Dynein_IC2 107..135 CDD:402922
WD40 316..632 CDD:421866 70/345 (20%)
WD40 repeat 316..365 CDD:293791 7/62 (11%)
WD40 repeat 371..409 CDD:293791 8/37 (22%)
WD40 repeat 418..457 CDD:293791 9/46 (20%)
WD40 repeat 469..555 CDD:293791 19/89 (21%)
WD40 repeat 561..599 CDD:293791 11/37 (30%)
WD40 repeat 607..633 CDD:293791 3/25 (12%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435291
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1587
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12442
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.