DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10859 and CG13074

DIOPT Version :9

Sequence 1:NP_001285898.1 Gene:CG10859 / 34756 FlyBaseID:FBgn0032520 Length:627 Species:Drosophila melanogaster
Sequence 2:NP_648835.1 Gene:CG13074 / 39760 FlyBaseID:FBgn0036567 Length:451 Species:Drosophila melanogaster


Alignment Length:267 Identity:54/267 - (20%)
Similarity:85/267 - (31%) Gaps:105/267 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 HDLWIPSRRLMTCEWLNNDPNQFLLFYSNRMSL--TPDYTKQLNTLPDFGNDNPHAFYIWNLDDA 223
            ||.|        ||.::   .|..||...|||:  ...|| :..|||                  
  Fly   150 HDDW--------CEHVD---QQLKLFVPQRMSVGNLVIYT-EAKTLP------------------ 184

  Fly   224 TRPAAHYDSRRVVRVAKVCLR-------DESYMVGGLQEGQVGFWLTENQGGPKSMCPLEACHRE 281
                           .|.|||       :::...|...:|::..||.|...|..|...::..:..
  Fly   185 ---------------LKSCLRSLCTNPFNKTMFAGSTMDGELFIWLYEQARGSDSSVDIKQLYSV 234

  Fly   282 ATT-----AICWVHSKLNTEFYSGSLDGSIKYWDTRDLLMPVHEVLAEPDPQTVQNRQDAHGVTF 341
            ::|     |:.|....|....::   :||::.||.                    :||.|     
  Fly   235 SSTQGAAVALDWPREHLLLACFA---NGSVRQWDL--------------------SRQMA----- 271

  Fly   342 LEFEYTIPVRF------IFCTDMGYLFVGNRKG-------TTPQDTIVAAYQLFAGPIRCVMRNP 393
            |::|||:|...      :....:....||...|       |..|...:...:|.|     :.|:.
  Fly   272 LDWEYTLPATVSSEPTAMVTLGLDDFVVGTNDGGVYRCWNTGRQTAAIKQIKLLA-----LRRHR 331

  Fly   394 FFVKNFL 400
            |.|...|
  Fly   332 FMVSTLL 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10859NP_001285898.1 WD40 <245..310 CDD:295369 13/69 (19%)
WD40 261..>512 CDD:225201 32/158 (20%)
WD40 279..492 CDD:295369 27/140 (19%)
WD40 repeat 284..332 CDD:293791 8/52 (15%)
WD40 repeat 386..422 CDD:293791 4/15 (27%)
WD40 repeat 429..454 CDD:293791
CG13074NP_648835.1 WD40 repeat 189..234 CDD:293791 9/44 (20%)
WD40 repeat 242..275 CDD:293791 11/60 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12442
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.