DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10859 and Dic61B

DIOPT Version :9

Sequence 1:NP_001285898.1 Gene:CG10859 / 34756 FlyBaseID:FBgn0032520 Length:627 Species:Drosophila melanogaster
Sequence 2:NP_728477.1 Gene:Dic61B / 38020 FlyBaseID:FBgn0263988 Length:764 Species:Drosophila melanogaster


Alignment Length:371 Identity:74/371 - (19%)
Similarity:120/371 - (32%) Gaps:104/371 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 YIWNLDDATRP--AAHYD--------SRRVVRVAKVCLRDESYM---VGGLQEGQVGFWLTENQG 267
            ::|::.:...|  |.:||        |..:..:..:.|.|.|..   |..||:..|.  :::...
  Fly   414 FLWSIKNPGEPERAYYYDVPVTAINFSPFLPSLLAIGLYDGSVEVRDVSSLQDTPVA--VSQRST 476

  Fly   268 GPKSMCPLEACHREATTAICWV-------HSKLNTEFYSGSLDGSIKYWDTRDLLMPVHEVLAEP 325
            .|.|         ....||.|:       |......|.|.|.|||:    ||      ..::..|
  Fly   477 SPGS---------SPVVAIRWIKQVSDDDHETDIDPFLSLSQDGSV----TR------FRIIKSP 522

  Fly   326 ----DPQTVQNRQDAH--GVTFLEFEYTIPVR-------------------FIFCTDMGYLFVGN 365
                ..|.:..|.:.|  |: |:.....||..                   :...||.|.:   :
  Fly   523 FLLGFTQMILERVEGHPEGI-FVHPSSRIPCESNRHPQGLSITTHPLHKDIYYVLTDEGCI---H 583

  Fly   366 RKGTTPQDTIVAAYQLFAGPIRCVMRNPFFVKNFLVVG-DWRVRIWSEEVKNCPSTFYFRRP-NQ 428
            :.....|...:...:...|.:..:..:|:..|.||..| ||.||||.:.:         .|| .:
  Fly   584 KCSINYQHQYLEVLRCHDGGVTVMEFSPWSPKLFLTCGNDWFVRIWVDGI---------TRPLLE 639

  Fly   429 LLS-------GAWSTGRCSLFCIGDNMGNLEFWDLLMSHKRPILTIKYKYAVTHLV-FKPDGTML 485
            ||.       ..||... |...:..|......||...:..||:...|...:...:. |...|..|
  Fly   640 LLDEMTPVHWAKWSPTH-STIIVTVNRETANVWDFRRNLLRPMSKHKMDSSFNTVARFSHCGRTL 703

  Fly   486 TVSLANGDCLML--------------RLEEGMRSATNKEKSLMMSM 517
            .:....|:.|..              .||:.:..|...:..|:|.:
  Fly   704 VIGNERGNTLFNALNDMPFSPHFQYDELEKAIFKAIGNDHELLMEL 749

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10859NP_001285898.1 WD40 <245..310 CDD:295369 18/74 (24%)
WD40 261..>512 CDD:225201 59/306 (19%)
WD40 279..492 CDD:295369 52/254 (20%)
WD40 repeat 284..332 CDD:293791 14/58 (24%)
WD40 repeat 386..422 CDD:293791 11/36 (31%)
WD40 repeat 429..454 CDD:293791 6/31 (19%)
Dic61BNP_728477.1 WD40 358..730 CDD:225201 69/350 (20%)
WD40 repeat 381..429 CDD:293791 3/14 (21%)
WD40 433..711 CDD:295369 62/312 (20%)
WD40 repeat 434..473 CDD:293791 8/40 (20%)
WD40 repeat 552..599 CDD:293791 4/49 (8%)
WD40 repeat 604..637 CDD:293791 12/41 (29%)
WD40 repeat 645..682 CDD:293791 8/37 (22%)
WD40 repeat 691..727 CDD:293791 5/35 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435272
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1587
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12442
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.