DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16957 and MAPR4

DIOPT Version :10

Sequence 1:NP_609650.1 Gene:CG16957 / 34755 FlyBaseID:FBgn0032519 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_567451.1 Gene:MAPR4 / 827155 AraportID:AT4G14965 Length:245 Species:Arabidopsis thaliana


Alignment Length:153 Identity:39/153 - (25%)
Similarity:70/153 - (45%) Gaps:37/153 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 IDVTLLIMSIVVFLKLGF------FARRLSREEPDFSDDNNQEVDLPPLRKDFTVRELREYDGTR 85
            :.||.:::.:.::.:..|      :.:||                       |:..||..|:||.
plant    13 VGVTFIVVLVSLYFRSSFKSPQHQYQKRL-----------------------FSAEELALYNGTD 54

  Fly    86 ADGRILVAILFNIYDVSRSVHYYGRNGVNPNYAGRDISRILIN---SPEDLKDSEDFDDLSDLSR 147
            ....||:.||.:::||::...:||..|...::||||.||..::   :.:.|.||     |..||.
plant    55 ETLPILLGILGSVFDVTKGKFHYGSGGGYNHFAGRDASRAFVSGNFTGDGLTDS-----LQGLSS 114

  Fly   148 NQMNTLREWEQRYKMKYPFVGKL 170
            :::.::.:|...|...|..||||
plant   115 SEVKSIVDWRGFYSRTYTPVGKL 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16957NP_609650.1 Cyt-b5 74..>127 CDD:459698 20/52 (38%)
MAPR4NP_567451.1 Cyt-b5 43..110 CDD:459698 23/71 (32%)

Return to query results.
Submit another query.