DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16957 and Nenf

DIOPT Version :10

Sequence 1:NP_609650.1 Gene:CG16957 / 34755 FlyBaseID:FBgn0032519 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_079700.1 Gene:Nenf / 66208 MGIID:1913458 Length:171 Species:Mus musculus


Alignment Length:117 Identity:37/117 - (31%)
Similarity:57/117 - (48%) Gaps:11/117 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 PPLRKDFTVRELREYDGTRADGRILVAILFNIYDVSRSVHYYGRNGVNPNYAGRDISRILIN--- 128
            ||:|. ||..||..|.|...|..|.:|:...::||:....:|||.......||:|.||.:..   
Mouse    41 PPVRL-FTEEELARYGGEEEDQPIYLAVKGVVFDVTSGKEFYGRGAPYNALAGKDSSRGVAKMSL 104

  Fly   129 SPEDLKDSEDFDDLSDLSRNQMNTLRE-WEQRYKMKYPFVGKLKEKLQINEE 179
            .|.||.     .|.:.|:..::..|.: :.:.||.|||.||....:: :||:
Mouse   105 DPADLT-----HDTTGLTAKELEALDDVFSKVYKAKYPIVGYTARRI-LNED 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16957NP_609650.1 Cyt-b5 74..>127 CDD:459698 18/52 (35%)
NenfNP_079700.1 Cyt-b5 47..109 CDD:459698 19/61 (31%)

Return to query results.
Submit another query.