DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16957 and Pgrmc2

DIOPT Version :10

Sequence 1:NP_609650.1 Gene:CG16957 / 34755 FlyBaseID:FBgn0032519 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001008375.1 Gene:Pgrmc2 / 361940 RGDID:1308804 Length:217 Species:Rattus norvegicus


Alignment Length:178 Identity:62/178 - (34%)
Similarity:103/178 - (57%) Gaps:11/178 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 TSWYCKLYNSLKETPIDVTLLIMSIVVFLKLGF-FARRLSREEPDFSDDNNQEVDLPPLRK-DFT 74
            :||...|..:..|..::|.|:.:.::...:|.. :.||.....|. :.:.:....||.::| ||:
  Rat    35 SSWVAALLATGGEMLLNVALVALVLLGAYRLWVRWGRRGLCSGPG-AGEESPAATLPRMKKRDFS 98

  Fly    75 VRELREYDGTRADGRILVAILFNIYDVSRSVHYYGRNGVNPNYAGRDISRILINSPEDLKDS--E 137
            :.:||:|||.|.. |||:|:...::||::...:||..|....:||||.||.|.....| ||:  :
  Rat    99 LEQLRQYDGARTP-RILLAVNGKVFDVTKGSKFYGPAGPYGIFAGRDASRGLATFCLD-KDALRD 161

  Fly   138 DFDDLSDLSRNQMNTLREWEQRYKMKYPFVGKL----KEKLQINEEED 181
            ::||||||:..||.::||||.::|.||.:||:|    :|..:..:|||
  Rat   162 EYDDLSDLNAVQMESVREWEMQFKEKYDYVGRLLKPGEEPSEYTDEED 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16957NP_609650.1 Cyt-b5 74..>127 CDD:459698 21/52 (40%)
Pgrmc2NP_001008375.1 Cyt-b5 98..161 CDD:459698 25/64 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 196..217 4/14 (29%)

Return to query results.
Submit another query.