DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16957 and PGRMC2

DIOPT Version :10

Sequence 1:NP_609650.1 Gene:CG16957 / 34755 FlyBaseID:FBgn0032519 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_006311.3 Gene:PGRMC2 / 10424 HGNCID:16089 Length:223 Species:Homo sapiens


Alignment Length:171 Identity:62/171 - (36%)
Similarity:97/171 - (56%) Gaps:30/171 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LLIMSIVVFLKLGFF------ARR-------LSREEPDFSDDNNQEVDLPPLRK-DFTVRELREY 81
            ||.:::|..:.||.:      .||       ...|.|..|        ||.::| ||::.:||:|
Human    55 LLNVALVALVLLGAYRLWVRWGRRGLGAGAGAGEESPATS--------LPRMKKRDFSLEQLRQY 111

  Fly    82 DGTRADGRILVAILFNIYDVSRSVHYYGRNGVNPNYAGRDISRILINSPEDLKDS--EDFDDLSD 144
            ||:| :.|||:|:...::||::...:||..|....:||||.||.|.....| ||:  :::|||||
Human   112 DGSR-NPRILLAVNGKVFDVTKGSKFYGPAGPYGIFAGRDASRGLATFCLD-KDALRDEYDDLSD 174

  Fly   145 LSRNQMNTLREWEQRYKMKYPFVGKL----KEKLQINEEED 181
            |:..||.::||||.::|.||.:||:|    :|..:..:|||
Human   175 LNAVQMESVREWEMQFKEKYDYVGRLLKPGEEPSEYTDEED 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16957NP_609650.1 Cyt-b5 74..>127 CDD:459698 21/52 (40%)
PGRMC2NP_006311.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..33
Cyt-b5 104..167 CDD:459698 25/64 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 202..223 4/14 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.