DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL24 and RPL24B

DIOPT Version :9

Sequence 1:NP_001285895.1 Gene:RpL24 / 34754 FlyBaseID:FBgn0032518 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_011664.3 Gene:RPL24B / 853051 SGDID:S000003380 Length:155 Species:Saccharomyces cerevisiae


Alignment Length:151 Identity:74/151 - (49%)
Similarity:100/151 - (66%) Gaps:3/151 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKIGLCAFSGYKIYPGHGKTMVKIDGKSFTFLDKKCERSYLMKRNPRKVTWTVLYRRKHRKGIEE 65
            ||:.:.:|||.|||||.|...|:.|.|.|.|.:.|....:..::|||::.||||:|:.|:|||.|
Yeast     1 MKVEVDSFSGAKIYPGRGTLFVRGDSKIFRFQNSKSASLFKQRKNPRRIAWTVLFRKHHKKGITE 65

  Fly    66 EASKKRTRRTQKFQRAIVGASLAEILAKRNMKPEVRKAQRDQAIKVAKEQKRAVKAAKKA--AAP 128
            |.:|||:|:|.|.||.|.||||..|..:|::|||||||.|::.:|..||:|||.|||:||  |..
Yeast    66 EVAKKRSRKTVKAQRPITGASLDLIKERRSLKPEVRKANREEKLKANKEKKRAEKAARKAEKAKS 130

  Fly   129 APAKKS-APKQKAAKVTQKAA 148
            |..:.| ..||:|....||.|
Yeast   131 AGVQGSKVSKQQAKGAFQKVA 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL24NP_001285895.1 Ribosomal_L24e 2..63 CDD:395998 26/60 (43%)
RPL24BNP_011664.3 Ribosomal_L24e 2..64 CDD:395998 27/61 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346251
Domainoid 1 1.000 72 1.000 Domainoid score I2215
eggNOG 1 0.900 - - E1_COG2075
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H763
Inparanoid 1 1.050 136 1.000 Inparanoid score I1209
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53708
OrthoFinder 1 1.000 - - FOG0002767
OrthoInspector 1 1.000 - - otm46469
orthoMCL 1 0.900 - - OOG6_101189
Panther 1 1.100 - - O PTHR10792
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1120
SonicParanoid 1 1.000 - - X1853
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.