DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL24 and RLP24

DIOPT Version :9

Sequence 1:NP_001285895.1 Gene:RpL24 / 34754 FlyBaseID:FBgn0032518 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_013109.1 Gene:RLP24 / 850695 SGDID:S000003999 Length:199 Species:Saccharomyces cerevisiae


Alignment Length:158 Identity:44/158 - (27%)
Similarity:70/158 - (44%) Gaps:34/158 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKIGLCAFSGYKIYPGHGKTMVKIDGKSFTFLDKKCERSYLMKRNPRKVTWTVLYRRKHRKGIEE 65
            |:|..|.|.....|||||...|:.|.|.|.|...||.:::..:|||||:.||..:|:...|.:..
Yeast     1 MRIYQCHFCSSPCYPGHGIMFVRNDAKEFRFCRSKCHKAFKQRRNPRKLKWTKAFRKAAGKELAV 65

  Fly    66 EASKKRTRRTQ---KFQRAIVG------ASLAEILAKR------------------------NMK 97
            :::....:|..   ::.|.:|.      |.:.||..||                        ...
Yeast    66 DSTLTFAQRRNVPVRYNRELVATTLKAMARIEEIRQKRERAFYKNRMRGNKEKDFLRDKKLVESN 130

  Fly    98 PE-VRKAQRDQAIKVAKEQKRAVKAAKK 124
            || :|..:.:.|.|:||||:||...:::
Yeast   131 PELLRIREVEIARKLAKEQERAESVSEQ 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL24NP_001285895.1 Ribosomal_L24e 2..63 CDD:395998 24/60 (40%)
RLP24NP_013109.1 Ribosomal_L24e 2..64 CDD:395998 24/61 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2075
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.