DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL24 and AT2G44860

DIOPT Version :9

Sequence 1:NP_001285895.1 Gene:RpL24 / 34754 FlyBaseID:FBgn0032518 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_001078059.1 Gene:AT2G44860 / 819095 AraportID:AT2G44860 Length:159 Species:Arabidopsis thaliana


Alignment Length:153 Identity:46/153 - (30%)
Similarity:71/153 - (46%) Gaps:33/153 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKIGLCAFSGYKIYPGHGKTMVKIDGKSFTFLDKKCERSYLMKRNPRKVTWTVLYRRKHRKGIEE 65
            |::..|.|....||||||...|:.|.|.|.|...||.:::.||||||||.||..:|..|.|.:.:
plant     1 MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAFRAAHGKDMTK 65

  Fly    66 EAS---KKRTRRTQKFQRAIVGASLAEI--LAK-----------RNMKPEVRKAQRD-------- 106
            :.:   :|:..|.:::.|.:...:|..|  :||           ..:||..:|...|        
plant    66 DTTFEFEKKRNRPERYDRNVTENTLMAIKKIAKIRTAREAKHIENRLKPNKQKKLNDDMKELDQN 130

  Fly   107 ---------QAIKVAKEQKRAVK 120
                     |.|||...:|::|:
plant   131 IHMVQAPGAQKIKVDVSEKKSVQ 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL24NP_001285895.1 Ribosomal_L24e 2..63 CDD:395998 28/60 (47%)
AT2G44860NP_001078059.1 Ribosomal_L24e 2..64 CDD:395998 28/61 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2075
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1502432at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.