DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL24 and RPL24A

DIOPT Version :9

Sequence 1:NP_001285895.1 Gene:RpL24 / 34754 FlyBaseID:FBgn0032518 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_565851.1 Gene:RPL24A / 818234 AraportID:AT2G36620 Length:164 Species:Arabidopsis thaliana


Alignment Length:162 Identity:67/162 - (41%)
Similarity:94/162 - (58%) Gaps:7/162 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKIGLCAFSGYKIYPGHGKTMVKIDGKSFTFLDKKCERSYLMKRNPRKVTWTVLYRRKHRKGIEE 65
            :|..||.|||.|||||.|...::.|.:.|.||:.||:|.:..|..|.|:.||.:||::|:|...:
plant     3 LKTELCRFSGQKIYPGRGIRFIRSDSQVFLFLNSKCKRYFHNKLKPSKLCWTAMYRKQHKKDAAQ 67

  Fly    66 EASKKRTRRTQK-FQRAIVGASLAEILAKRNMKPEVRKAQRDQAIKVAKEQKRAVKAAKKAAAPA 129
            ||.|:|.|.|:| :.|:||||:|..|..||..|||||.|.|:.|::..||:.:..|..|||....
plant    68 EAVKRRRRATKKPYSRSIVGATLEVIQKKRAEKPEVRDAAREAALREIKERIKKTKDEKKAKKVE 132

  Fly   130 PAKKSAPKQKAAKVTQKAAPRV------GGKR 155
            .|.|....|....:.:.|||:.      ||:|
plant   133 YASKQQKSQVKGNIPKSAAPKAAKMGGGGGRR 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL24NP_001285895.1 Ribosomal_L24e 2..63 CDD:395998 28/60 (47%)
RPL24ANP_565851.1 Ribosomal_L24e 4..64 CDD:395998 27/59 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 67 1.000 Domainoid score I3518
eggNOG 1 0.900 - - E1_COG2075
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H763
Inparanoid 1 1.050 123 1.000 Inparanoid score I1959
OMA 1 1.010 - - QHG53708
OrthoDB 1 1.010 - - D1502432at2759
OrthoFinder 1 1.000 - - FOG0002767
OrthoInspector 1 1.000 - - otm3375
orthoMCL 1 0.900 - - OOG6_101189
Panther 1 1.100 - - O PTHR10792
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1853
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.840

Return to query results.
Submit another query.