DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL24 and RpL24-like

DIOPT Version :9

Sequence 1:NP_001285895.1 Gene:RpL24 / 34754 FlyBaseID:FBgn0032518 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_650073.1 Gene:RpL24-like / 41372 FlyBaseID:FBgn0037899 Length:191 Species:Drosophila melanogaster


Alignment Length:171 Identity:52/171 - (30%)
Similarity:79/171 - (46%) Gaps:31/171 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKIGLCAFSGYKIYPGHGKTMVKIDGKSFTFLDKKCERSYLMKRNPRKVTWTVLYRRKHRKGIEE 65
            |:|..|.|...|||||||...|:.|.|.|.|...||.:::..|:|||||.||..||:...|.:..
  Fly     1 MRIQTCYFCSSKIYPGHGVQFVRNDCKVFKFCRGKCHKAFKRKKNPRKVGWTKAYRKAAGKELAI 65

  Fly    66 EAS---KKRTRRTQKFQRAIVGASL------AEILAKR---------------NMKPEVRKAQRD 106
            :.|   :||.....|:.|......|      .||..||               .::.:|:..||:
  Fly    66 DPSFEFEKRRNVPMKYSRETWQKGLEAIKRVTEIKEKRTSHFVMERLRKGRQVEIQMDVKDVQRN 130

  Fly   107 QAI----KVAKEQKRAVKAAKKAAAPAPAKKSAPKQKAAKV 143
            .::    ....:|:||.:||::||.   .::..|::|...|
  Fly   131 MSLIRSPAAGLKQRRAQEAAEEAAL---MEEDLPEEKITYV 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL24NP_001285895.1 Ribosomal_L24e 2..63 CDD:395998 28/60 (47%)
RpL24-likeNP_650073.1 Ribosomal_L24e 2..64 CDD:279571 28/61 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469215
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2075
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1502432at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10792
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.