DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL24 and rsl24d1

DIOPT Version :9

Sequence 1:NP_001285895.1 Gene:RpL24 / 34754 FlyBaseID:FBgn0032518 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_998158.1 Gene:rsl24d1 / 406266 ZFINID:ZDB-GENE-040426-1925 Length:161 Species:Danio rerio


Alignment Length:171 Identity:54/171 - (31%)
Similarity:77/171 - (45%) Gaps:34/171 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKIGLCAFSGYKIYPGHGKTMVKIDGKSFTFLDKKCERSYLMKRNPRKVTWTVLYRRKHRKGIEE 65
            |:|..|.|....:|||||...|:.|.|.|.|...||.:::..||||||..||..:|:...|.:..
Zfish     1 MRIEKCYFCSAPVYPGHGMMFVRNDCKVFRFCRSKCHKNFKKKRNPRKTRWTKAFRKSAGKELTV 65

  Fly    66 EAS---KKRTRRTQKFQRAIVGASLAEILAKRNMKPEVRKAQRDQAIKVAKEQKRAV-------K 120
            :.|   :||.....|:.|        |:.:|     .|...::.::|| .|.|.|.:       |
Zfish    66 DNSLEFEKRRNTPVKYNR--------ELWSK-----TVEAMRKVESIK-HKRQARFIMNRLKKGK 116

  Fly   121 AAKKAAAPAPAKKS-----AP-----KQKAAKVTQKAAPRV 151
            ..:|||..:..||:     ||     ||...|:.||.|..|
Zfish   117 ELEKAADISEVKKNIHLIKAPHAGQAKQLEDKMVQKLAEDV 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL24NP_001285895.1 Ribosomal_L24e 2..63 CDD:395998 25/60 (42%)
rsl24d1NP_998158.1 Ribosomal_L24e 2..64 CDD:279571 25/61 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2075
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1502432at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.