Sequence 1: | NP_001285895.1 | Gene: | RpL24 / 34754 | FlyBaseID: | FBgn0032518 | Length: | 155 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_038956284.1 | Gene: | RGD1560821 / 367865 | RGDID: | 1560821 | Length: | 194 | Species: | Rattus norvegicus |
Alignment Length: | 195 | Identity: | 99/195 - (50%) |
---|---|---|---|
Similarity: | 120/195 - (61%) | Gaps: | 41/195 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MKIGLCAFSGYKIYPGHGKTMVKIDGK-------------------------------------S 28
Fly 29 FTFLDKKCERSYLMKRNPRKVTWTVLYRRKHRKGIEEEASKKRTRRTQKFQRAIVGASLAEILAK 93
Fly 94 RNMKPEVRKAQRDQAIKVAKEQKRAVKAAKK---AAAPAPAKKSAPKQKAAKVTQKAAPRVGGKR 155
Fly 156 155 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
RpL24 | NP_001285895.1 | Ribosomal_L24e | 2..63 | CDD:395998 | 37/97 (38%) |
RGD1560821 | XP_038956284.1 | Ribosomal_L24e | 2..100 | CDD:395998 | 37/97 (38%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 112 | 1.000 | Domainoid score | I6058 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 209 | 1.000 | Inparanoid score | I3602 |
OMA | 1 | 1.010 | - | - | QHG53708 | |
OrthoDB | 1 | 1.010 | - | - | D622560at33208 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0002767 | |
OrthoInspector | 1 | 1.000 | - | - | otm44374 | |
orthoMCL | 1 | 0.900 | - | - | OOG6_101189 | |
Panther | 1 | 1.100 | - | - | O | PTHR10792 |
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 1 | 1.000 | - | - | X1853 | |
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
12 | 11.980 |