DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL24 and RGD1560821

DIOPT Version :9

Sequence 1:NP_001285895.1 Gene:RpL24 / 34754 FlyBaseID:FBgn0032518 Length:155 Species:Drosophila melanogaster
Sequence 2:XP_038956284.1 Gene:RGD1560821 / 367865 RGDID:1560821 Length:194 Species:Rattus norvegicus


Alignment Length:195 Identity:99/195 - (50%)
Similarity:120/195 - (61%) Gaps:41/195 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKIGLCAFSGYKIYPGHGKTMVKIDGK-------------------------------------S 28
            ||:.||:|||||||||||:...:.|.|                                     .
  Rat     1 MKVELCSFSGYKIYPGHGRHYARTDRKVFQFLSFFLSFFFFFWFFFSELGTESRALHFLGKCSTV 65

  Fly    29 FTFLDKKCERSYLMKRNPRKVTWTVLYRRKHRKGIEEEASKKRTRRTQKFQRAIVGASLAEILAK 93
            |.||:.|||.::|.||||:::.|||||||||:||..||..||||.|..||||||.|||:|:|:||
  Rat    66 FQFLNDKCESAFLSKRNPQQINWTVLYRRKHKKGQLEEIQKKRTSRAVKFQRAITGASVADIMAK 130

  Fly    94 RNMKPEVRKAQRDQAIKVAKEQKRAVKAAKK---AAAPAPAKKSAPKQKAAKVTQKAAPRVGGKR 155
            :|.|||||||||.|||:.|||.|:|.:|.||   |||.||. |:.||||..|..:.:||||||||
  Rat   131 KNQKPEVRKAQRKQAIRAAKEAKKAKQAWKKTAMAAAKAPT-KADPKQKILKPMKVSAPRVGGKR 194

  Fly   156  155
              Rat   195  194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL24NP_001285895.1 Ribosomal_L24e 2..63 CDD:395998 37/97 (38%)
RGD1560821XP_038956284.1 Ribosomal_L24e 2..100 CDD:395998 37/97 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 112 1.000 Domainoid score I6058
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 209 1.000 Inparanoid score I3602
OMA 1 1.010 - - QHG53708
OrthoDB 1 1.010 - - D622560at33208
OrthoFinder 1 1.000 - - FOG0002767
OrthoInspector 1 1.000 - - otm44374
orthoMCL 1 0.900 - - OOG6_101189
Panther 1 1.100 - - O PTHR10792
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1853
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.980

Return to query results.
Submit another query.