DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL24 and rpl-24.1

DIOPT Version :9

Sequence 1:NP_001285895.1 Gene:RpL24 / 34754 FlyBaseID:FBgn0032518 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_491399.1 Gene:rpl-24.1 / 172062 WormBaseID:WBGene00004436 Length:159 Species:Caenorhabditis elegans


Alignment Length:160 Identity:81/160 - (50%)
Similarity:109/160 - (68%) Gaps:6/160 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKIGLCAFSGYKIYPGHGKTMVKIDGKSFTFLDKKCERSYLMKRNPRKVTWTVLYRRKHRKGI-- 63
            ||:..|.:|||||:|||||.:|:.|||...||..|..:...::||||.:.||||||.|::||.  
 Worm     1 MKVETCVYSGYKIHPGHGKRLVRTDGKVQIFLSGKALKGAKLRRNPRDIRWTVLYRIKNKKGTHG 65

  Fly    64 EEEASKKRTRRT-QKFQRAIVGASLAEILAKRNMKPEVRKAQRDQAIKVAKEQKRAVKAAKKAAA 127
            :|:.::|:|::: |...||:.|.||..||||||...:.|:.||:||.|:||:..:||:|| ||||
 Worm    66 QEQVTRKKTKKSVQVVNRAVAGLSLDAILAKRNQTEDFRRQQREQAAKIAKDANKAVRAA-KAAA 129

  Fly   128 PAPAKKSAPK--QKAAKVTQKAAPRVGGKR 155
            ....|.|.||  ||.||..:.|||||||||
 Worm   130 NKEKKASQPKTQQKTAKNVKTAAPRVGGKR 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL24NP_001285895.1 Ribosomal_L24e 2..63 CDD:395998 31/60 (52%)
rpl-24.1NP_491399.1 Ribosomal_L24e 2..64 CDD:279571 32/61 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166732
Domainoid 1 1.000 79 1.000 Domainoid score I5641
eggNOG 1 0.900 - - E1_COG2075
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H763
Inparanoid 1 1.050 148 1.000 Inparanoid score I2993
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53708
OrthoDB 1 1.010 - - D1502432at2759
OrthoFinder 1 1.000 - - FOG0002767
OrthoInspector 1 1.000 - - oto19674
orthoMCL 1 0.900 - - OOG6_101189
Panther 1 1.100 - - LDO PTHR10792
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1120
SonicParanoid 1 1.000 - - X1853
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1615.840

Return to query results.
Submit another query.