DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7099 and LOC110439995

DIOPT Version :9

Sequence 1:NP_609648.1 Gene:CG7099 / 34753 FlyBaseID:FBgn0032517 Length:1906 Species:Drosophila melanogaster
Sequence 2:XP_021333887.1 Gene:LOC110439995 / 110439995 -ID:- Length:256 Species:Danio rerio


Alignment Length:249 Identity:58/249 - (23%)
Similarity:96/249 - (38%) Gaps:73/249 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   303 FETKQVERPVAPLT------------KSGKQSKATTRKVTVIQLRNPDMQLKDLYKNDDSEDNQV 355
            |..::::||..|.|            ...|.|.|..|:...| ::||...|.  |:         
Zfish    25 FLNRKLKRPFVPWTVVRDILHAEFDSSQDKTSLAVGRRSRYI-MKNPQTCLN--YR--------- 77

  Fly   356 SEFLDLGHCFLDMPPEEEVFRAVARFGKRGLNSNELCHYTGINATYMRHFVKRVKKHGLVKEYSE 420
                   .|..:|..::|:   ::||..|..:.|:|    .:.|...:.||..::     .::|.
Zfish    78 -------ICLAEMYQDKEL---ISRFSSRTGDYNDL----QVCALEYKEFVSALR-----SKFSS 123

  Fly   421 QVGKS-------RQ-----FRFVAVGHLGDLSKEDEIKKKALEIRCKDEPNITESTDVLLKDLPE 473
            ..|.|       ||     |:..|||. ..|.:..::.||..:|......|:.:||.||      
Zfish   124 SYGPSDVIIPDTRQQLFDRFKVYAVGD-DSLQRTQDVLKKQEDIDVLVLFNLIQSTLVL------ 181

  Fly   474 IVTNA-----RPIAFKIKKTRAANQTQRQINRQKMIVRQIDQNCLVSLPRVLRS 522
              |||     ||  |:: .|.......|..:|...|.:.:|::..:..| :|||
Zfish   182 --TNAQMKNYRP--FQV-HTHTHIHRCRHTHRATHIHKNVDKDTQLHFP-LLRS 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7099NP_609648.1 B-block_TFIIIC 173..249 CDD:252431
LOC110439995XP_021333887.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D143012at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.