DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ing5 and YNG1

DIOPT Version :9

Sequence 1:NP_609647.1 Gene:Ing5 / 34752 FlyBaseID:FBgn0032516 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_014707.1 Gene:YNG1 / 854230 SGDID:S000005590 Length:219 Species:Saccharomyces cerevisiae


Alignment Length:273 Identity:77/273 - (28%)
Similarity:107/273 - (39%) Gaps:92/273 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 NYLDGLESLPTELERNFKLMRKLDDRAQTAMKSIDSHAKDFMRKLGENGAMSEDERRERQEDIKA 73
            ::|..|:.||.||.|:.:||:.:|                    |.:|   .|||.         
Yeast    16 SFLSTLDHLPCELIRSLRLMQTID--------------------LFKN---EEDEP--------- 48

  Fly    74 LFGKAKEYSDDKVQLAIQTY--ELVDKQIRRLDNDLARFEGEIQEKASSTRAKSEEVVAKKGRKK 136
              |..:...|   .|.:.||  :|||.||..|...  :.|.|||:..                  
Yeast    49 --GMERACRD---LLLVATYINDLVDDQIHFLKQH--KKELEIQKSV------------------ 88

  Fly   137 TKDSKTTGKKKKSASSDEETGRGNNQSNANSSVNSSSNAGQGSKKKKSKVNQEKETRK--GGAQK 199
            ||:..::.:..||..:.||.| ...:......:|        .||.||:..:|..|..  |..|.
Yeast    89 TKNFNSSLENIKSKLTLEEPG-AYKEPKLLLKIN--------LKKAKSRERKESITSPTIGINQG 144

  Fly   200 KTVEVDDSEKESCHTAATHPSDVMDMPVDPNEPTYCLCHQVSYGEMIGCDNPDCPIEWFHFACVG 264
            ...|.:::::|                      .||.|..||||.|:.||||.||.||||:.|||
Yeast   145 DVTEGNNNQEE----------------------VYCFCRNVSYGPMVACDNPACPFEWFHYGCVG 187

  Fly   265 LTTKPKGKWFCPK 277
            |...|||||:|.|
Yeast   188 LKQAPKGKWYCSK 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ing5NP_609647.1 TNG2 1..278 CDD:227367 77/273 (28%)
ING 6..108 CDD:289749 26/100 (26%)
PHD_ING4_5 234..278 CDD:277061 29/44 (66%)
YNG1NP_014707.1 TNG2 1..206 CDD:227367 77/273 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1994
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000296
OrthoInspector 1 1.000 - - otm46939
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10333
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2364
SonicParanoid 1 1.000 - - X195
TreeFam 00.000 Not matched by this tool.
87.890

Return to query results.
Submit another query.