DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ing5 and ING5

DIOPT Version :9

Sequence 1:NP_609647.1 Gene:Ing5 / 34752 FlyBaseID:FBgn0032516 Length:285 Species:Drosophila melanogaster
Sequence 2:XP_016860586.1 Gene:ING5 / 84289 HGNCID:19421 Length:300 Species:Homo sapiens


Alignment Length:275 Identity:137/275 - (49%)
Similarity:175/275 - (63%) Gaps:46/275 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LDGLESLPTELERNFKLMRKLDDRAQTAMKSIDSHAKDFMRKLGENGAMSEDERRERQEDIKALF 75
            :.|:|:||.||:|||:|||:||.|.:.....||..|.:::..:   ..:|.|:|.||.:.|:..:
Human    71 ITGIENLPCELQRNFQLMRELDQRTEDKKAEIDILAAEYISTV---KTLSPDQRVERLQKIQNAY 132

  Fly    76 GKAKEYSDDKVQLAIQTYELVDKQIRRLDNDLARFEGEIQEKASSTRAKSEEVVAKKGRKKTKDS 140
            .|.|||||||||||:||||:|||.|||||.||||||.::::|...:..:|.   ..:|.||.:  
Human   133 SKCKEYSDDKVQLAMQTYEMVDKHIRRLDADLARFEADLKDKMEGSDFESS---GGRGLKKGR-- 192

  Fly   141 KTTGKKKKSASSDEETGRGNNQSNANSSVNSSSNAGQGSKKKKSKVNQEKETRKGGAQKKTVEVD 205
               |:|:|..|    .|||...|..::           .||||         .|||:     |..
Human   193 ---GQKEKRGS----RGRGRRTSEEDT-----------PKKKK---------HKGGS-----EFT 225

  Fly   206 DSEKESCHTAATHPSDVMDMPVDPNEPTYCLCHQVSYGEMIGCDNPDCPIEWFHFACVGLTTKPK 270
            |:      ..:.|||||:||||||||||||||||||||||||||||||||||||||||.||||||
Human   226 DT------ILSVHPSDVLDMPVDPNEPTYCLCHQVSYGEMIGCDNPDCPIEWFHFACVDLTTKPK 284

  Fly   271 GKWFCPKCTQDRKKK 285
            ||||||:|.|:::||
Human   285 GKWFCPRCVQEKRKK 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ing5NP_609647.1 TNG2 1..278 CDD:227367 133/266 (50%)
ING 6..108 CDD:289749 49/96 (51%)
PHD_ING4_5 234..278 CDD:277061 42/43 (98%)
ING5XP_016860586.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154588
Domainoid 1 1.000 162 1.000 Domainoid score I3986
eggNOG 1 0.900 - - E1_COG5034
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 266 1.000 Inparanoid score I3053
Isobase 1 0.950 - 0 Normalized mean entropy S1994
OMA 1 1.010 - - QHG55959
OrthoDB 1 1.010 - - D1434088at2759
OrthoFinder 1 1.000 - - FOG0000296
OrthoInspector 1 1.000 - - otm40874
orthoMCL 1 0.900 - - OOG6_101415
Panther 1 1.100 - - O PTHR10333
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2364
SonicParanoid 1 1.000 - - X195
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.750

Return to query results.
Submit another query.