DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ing5 and ING1

DIOPT Version :9

Sequence 1:NP_609647.1 Gene:Ing5 / 34752 FlyBaseID:FBgn0032516 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_566742.1 Gene:ING1 / 821986 AraportID:AT3G24010 Length:234 Species:Arabidopsis thaliana


Alignment Length:293 Identity:89/293 - (30%)
Similarity:136/293 - (46%) Gaps:77/293 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YLENYLDGLESLPTELERNFKLMRKLDDRAQTAMKS----IDSHAKDFMRKLGENG--------- 57
            :.|.:...|.||...|::.:.|:|.||...|...:.    .:...:|..|  |..|         
plant     3 FAEEFEANLVSLAHVLQKKYALLRDLDKSLQENQRQNEQRCEKEIEDIRR--GRAGNITPNTSLT 65

  Fly    58 AMSEDERRERQEDIKALFGKAKEYSDDKVQLAIQTYELVDKQIRRLDNDLARFEGEIQEKASSTR 122
            ..||:...|::..::        .:|:||.||:|.|:|||..:::||..:               
plant    66 KFSEEALDEQKHSVR--------IADEKVTLAMQAYDLVDMHVQQLDQYM--------------- 107

  Fly   123 AKSEEVVAKKGRKKTKDSKTTGKKKKSASSDEETGRGNNQSNANSSVNSSSNAGQGSKKKKSKVN 187
            .||:||:.|             :|:.:|::.|....|           .:.|||:|.:       
plant   108 KKSDEVIRK-------------EKEAAAATLELENNG-----------KAGNAGEGGR------- 141

  Fly   188 QEKETRKGGAQKKTVEVDDSEKESCHTAATHPSDVMDMPVDPNEPTYCLCHQVSYGEMIGCDNPD 252
                    |.:|||.....:...:..|..|..:..:|:||||||||||:|:|||:|||:.|||..
plant   142 --------GGRKKTRLATAASTAAASTGMTSSNMDLDLPVDPNEPTYCICNQVSFGEMVACDNNA 198

  Fly   253 CPIEWFHFACVGLTTKPKGKWFCPKCTQDRKKK 285
            |.||||||.||||..:|||||:||:|...:|.:
plant   199 CKIEWFHFGCVGLKEQPKGKWYCPECATVKKSR 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ing5NP_609647.1 TNG2 1..278 CDD:227367 87/284 (31%)
ING 6..108 CDD:289749 29/114 (25%)
PHD_ING4_5 234..278 CDD:277061 30/43 (70%)
ING1NP_566742.1 ING_plant 11..107 CDD:341097 28/105 (27%)
PHD_Yng1p_like 180..225 CDD:277062 30/44 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 116 1.000 Domainoid score I1978
eggNOG 1 0.900 - - E1_COG5034
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55959
OrthoDB 1 1.010 - - D1434088at2759
OrthoFinder 1 1.000 - - FOG0000296
OrthoInspector 1 1.000 - - oto4123
orthoMCL 1 0.900 - - OOG6_101415
Panther 1 1.100 - - LDO PTHR10333
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X195
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.790

Return to query results.
Submit another query.