DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ing5 and Ing2

DIOPT Version :9

Sequence 1:NP_609647.1 Gene:Ing5 / 34752 FlyBaseID:FBgn0032516 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_075992.2 Gene:Ing2 / 69260 MGIID:1916510 Length:281 Species:Mus musculus


Alignment Length:279 Identity:91/279 - (32%)
Similarity:150/279 - (53%) Gaps:41/279 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YLENYLDGLESLPTELERNFKLMRKLDDRAQTAMKSIDSHAKDFMRKLGENGAMSEDERRERQED 70
            |:::||:.:||||.:::||..::|:||::.|..:|.||...:.:.::...|      :::..|:.
Mouse    28 YVQDYLECVESLPHDMQRNVSVLRELDNKYQETLKEIDDVYEKYKKEDDSN------QKKRLQQH 86

  Fly    71 IKALFGKAKEYSDDKVQLAIQTYELVDKQIRRLDNDLARFEGEIQEKASSTRAKSEEVVAKKGRK 135
            ::.....::|..|:|:|:..|..|||:.:.|:::.....|    |:.|.|.||..:   :|....
Mouse    87 LQRALINSQELGDEKIQIVTQMLELVENRARQMELHSQCF----QDPAESERASDK---SKMDSS 144

  Fly   136 KTKDSKTTGKKKKSASSDEETGRGNNQSNANSSVNSSSNAGQGSKKKKSKVNQEKETRKGGAQKK 200
            :.:.|....::::::.|.:.....|...:.:........:....|||:||..||:|         
Mouse   145 QPERSSRRPRRQRTSESRDLCHMTNGIDDCDDQPPKEKRSKSAKKKKRSKAKQERE--------- 200

  Fly   201 TVEVDDSEKESCHTAATHPSDVMDMPVDPNEPTYCLCHQVSYGEMIGCDNPDCPIEWFHFACVGL 265
                               :..::..:||||||||||:||||||||||||..||||||||:||.|
Mouse   201 -------------------ASPVEFAIDPNEPTYCLCNQVSYGEMIGCDNEQCPIEWFHFSCVSL 246

  Fly   266 TTKPKGKWFCPKCTQDRKK 284
            |.||||||:||||..|.:|
Mouse   247 TYKPKGKWYCPKCRGDNEK 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ing5NP_609647.1 TNG2 1..278 CDD:227367 87/271 (32%)
ING 6..108 CDD:289749 27/101 (27%)
PHD_ING4_5 234..278 CDD:277061 36/43 (84%)
Ing2NP_075992.2 ING 28..122 CDD:289749 27/99 (27%)
TNG2 31..260 CDD:227367 87/269 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 123..204 18/115 (16%)
PHD_ING2 214..262 CDD:277153 39/47 (83%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 261..281 2/5 (40%)
PBR. /evidence=ECO:0000250|UniProtKB:Q9H160 265..281 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1434088at2759
OrthoFinder 1 1.000 - - FOG0000296
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2364
SonicParanoid 1 1.000 - - X195
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.