DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ing5 and ing1

DIOPT Version :9

Sequence 1:NP_609647.1 Gene:Ing5 / 34752 FlyBaseID:FBgn0032516 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_001035446.1 Gene:ing1 / 678608 ZFINID:ZDB-GENE-060421-4388 Length:309 Species:Danio rerio


Alignment Length:309 Identity:104/309 - (33%)
Similarity:158/309 - (51%) Gaps:63/309 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YLENYLDGLESLPTELERNFKLMRKLDDRAQTAMKSIDSHAKDFMRKLGENGAMSED--ERRERQ 68
            |:|.||:.:||||.:|:|...||:::|.:.|..:..:|        :..|......|  :||...
Zfish    17 YVEEYLELVESLPLDLQRCVSLMKEIDAKYQEILNELD--------EAYEKHRQESDPVQRRRLL 73

  Fly    69 EDIKALFGKAKEYSDDKVQLAIQTYELVDKQIRRLDNDLARFEGEIQE----------------K 117
            ..|:....:.:|..|:|:|:|.|..|:|:.:.|:|:     :.||:.:                .
Zfish    74 HCIQRSLIRTEELGDEKIQIAGQMVEMVENRSRQLE-----WHGELFQASHDSPESSVSVGSTPS 133

  Fly   118 ASSTRA---------KSEEVVAKKGRKKTKDS--KTTGKKKKSASSDEETGRGNNQSNANSSVNS 171
            |.:|.|         .:.::.|.:.|::|..|  |:.||:.:...:..|     |:.|:|.|:..
Zfish   134 AITTTAMTTISDILLSASKLTANRRREETPSSVDKSGGKRSRRQKNGSE-----NRENSNYSLEH 193

  Fly   172 SSNAGQGS-KKKKSKVNQEKETRKGGAQKKTVEVDDSEKESCHTAATHPSDVMDMPVDPNEPTYC 235
            ..:...|: |:||.|.:.....:|    |::....|.|          ||.. |:|:||||||||
Zfish   194 IEDVSSGTPKEKKPKASATSSKKK----KRSKSKQDRE----------PSPT-DLPIDPNEPTYC 243

  Fly   236 LCHQVSYGEMIGCDNPDCPIEWFHFACVGLTTKPKGKWFCPKCTQDRKK 284
            ||.||||||||||||.:|.||||||:||.|..||||||:||||..|.:|
Zfish   244 LCEQVSYGEMIGCDNDECTIEWFHFSCVDLHHKPKGKWYCPKCRGDNEK 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ing5NP_609647.1 TNG2 1..278 CDD:227367 100/301 (33%)
ING 6..108 CDD:289749 30/103 (29%)
PHD_ING4_5 234..278 CDD:277061 34/43 (79%)
ing1NP_001035446.1 ING 17..111 CDD:289749 30/106 (28%)
TNG2 18..287 CDD:227367 100/301 (33%)
PHD_ING1_2 242..286 CDD:277059 34/43 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1434088at2759
OrthoFinder 1 1.000 - - FOG0000296
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2364
SonicParanoid 1 1.000 - - X195
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.