DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ing5 and ing2

DIOPT Version :9

Sequence 1:NP_609647.1 Gene:Ing5 / 34752 FlyBaseID:FBgn0032516 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_001017044.1 Gene:ing2 / 549798 XenbaseID:XB-GENE-951849 Length:279 Species:Xenopus tropicalis


Alignment Length:279 Identity:92/279 - (32%)
Similarity:149/279 - (53%) Gaps:41/279 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YLENYLDGLESLPTELERNFKLMRKLDDRAQTAMKSIDSHAKDFMRKLGENGAMSEDERRERQED 70
            |:|.||:.:||||.|::|:..|:|::|.:.:.|:|.:|    |...| ..|...:..::|..|:.
 Frog    26 YVEEYLECVESLPLEIQRSVTLLREIDSQYREALKEVD----DVFEK-HSNETDANQKKRLLQQL 85

  Fly    71 IKALFGKAKEYSDDKVQLAIQTYELVDKQIRRLDNDLARFEGEIQEKASSTRAKSEEVVAKKGRK 135
            .:||. ..:|..|||:||..|.:||::.:.:::::....|..:.:.:.|..::|.|...:::..:
 Frog    86 QRALI-VTQELGDDKIQLVTQVFELIENRTKQMESLCQGFFDQEESEKSVEKSKVESNASERSTR 149

  Fly   136 KTKDSKTTGKKKKSASSDEETGRGNNQSNANSSVNSSSNAGQGSKKKKSKVNQEKETRKGGAQKK 200
            :.       ::::::.|.|.....|...:..........:....|||:||..||:|         
 Frog   150 RP-------RRQRNSESRELCHMVNGMDDIEEQPPKEKKSKSSKKKKRSKAKQERE--------- 198

  Fly   201 TVEVDDSEKESCHTAATHPSDVMDMPVDPNEPTYCLCHQVSYGEMIGCDNPDCPIEWFHFACVGL 265
                               :..:...:||||||||||:||||||||||||.:|.||||||:||||
 Frog   199 -------------------ASPIPFAIDPNEPTYCLCNQVSYGEMIGCDNDECTIEWFHFSCVGL 244

  Fly   266 TTKPKGKWFCPKCTQDRKK 284
            |.||||||:||.|..|.:|
 Frog   245 TYKPKGKWYCPDCRGDNEK 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ing5NP_609647.1 TNG2 1..278 CDD:227367 89/271 (33%)
ING 6..108 CDD:289749 32/101 (32%)
PHD_ING4_5 234..278 CDD:277061 36/43 (84%)
ing2NP_001017044.1 ING 31..118 CDD:355795 29/92 (32%)
PHD_ING1_2 213..257 CDD:277059 36/43 (84%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1434088at2759
OrthoFinder 1 1.000 - - FOG0000296
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X195
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.